Conserved Protein Domain Family
EutH_ACDH

?
TIGR02518: EutH_ACDH 
acetaldehyde dehydrogenase (acetylating)
Statistics
?
PSSM-Id: 131570
View PSSM: TIGR02518
Aligned: 4 rows
Threshold Bit Score: 832.202
Threshold Setting Gi: 28203558
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562    5 DKDLVSIQETRGLIRKAKEAQSKLARMSQQDIDRIVKAISDAAYENSEKLAKMANEETGFGKWEDKVLKNVFAARTVYES 84
gi 19713512    2 DRDLLSIQQVRDLIKSAKVAQKLYSTFTQEQIDKVVCAIVEEMKNHYVDLAKKANEETGFGKCEDKVIKNKFANEFVYDC 81
gi 28203558    5 DKDLYSIQQARNLARLGKVAANKIANYTEEQIDKILRNMVRVAEENAVSLAQMAVEETGFGKVEDKTYKNHLAATILYDS 84
gi 489858135   5 DKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIADAGYDAREKLAKMAHEETGFGIWQDKVIKNVFASKHVYNY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562   85 IKDTKTVGIVEENveKRAFKIMVPVGVVAGLIPSTNPTSTAIYKAMISIKARNAIVLSPHPSAKKCIIETAKIIAKAAER 164
gi 19713512   82 IKDMKTVGILNET--DTVTEVGVPMGIVAALTPSTNPTSTAIYKTLISLKAGNAIIVSPHPNAKNCVIDTVKLMQKAAYA 159
gi 28203558   85 IKDMKTIGVISEDkvNKMIEIAEPVGLIMGIVPSTNPTSTAIFKSIIAIKSRNAIVFSPHPAAAKCTIRAVELMRDAAIE 164
gi 489858135  85 IKDMKTIGMLKEDneKKVMEVAVPLGVVAGLIPSTNPTSTVIYKTLISIKAGNSIVFSPHPNALKAILETVRIISEAAEK 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562  165 AGCPEGAIGCITVPSIEGTNELMKNKDTSLILATGGEAMVRAAYSSGTPAIGVGPGNGPAFIDKSADVKLAVKRILDSKT 244
gi 19713512  160 AGAPVGLIGVIEIPTIEGTNELMKSKDTSIILATGGEAMVRAAYSSGRPAIGVGPGNGPAYIEKTANIKEAVRKIIESKT 239
gi 28203558  165 AGAPEDIIASLTNLTMEATNELMKNENVSLIIATGGPGMVKAAYSSGKPAIGVGAGNSPAYIERTANVEKAIRDIISSKS 244
gi 489858135 165 AGCPKGAISCMTVPTIQGTDQLMKHKDTAVILATGGSAMVKAAYSSGTPAIGVGPGNGPAFIERSANIPRAVKHILDSKT 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562  245 FDNGTICASEQSIVVEKAMEDEVVRELKEQGAYFLTEEQANQLSKFVMRANGTMNPQIVGKTPQDIAKLAGLEgIPSWAR 324
gi 19713512  240 FDNGVICASEQSVIVEPCNKEAVMDEFRRQGGFFLSKEESEKLGRFILRPNGTMNPQIVGKDAQTLAKLAGLN-IPLNVK 318
gi 28203558  245 FDYGTICASEQSIICEECNHDAVVEELKKQGGYFMTAEETEKVCKLLFKNGHTMNAKFVGRSPQVIANAAGFT-VSEDIK 323
gi 489858135 245 FDNGTICASEQSVVVERVNKEAVIAEFRKQGAHFLSDAEAVQLGKFILRPNGSMNPAIVGKSVQHIANLAGLT-VPADAR 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562  325 VLVPRECHVGHKYPFSREKLTTILTFFVEENVDAVLNRCREILLNEGAGHTFCMHANNEELVKRFALEMPVSRMVVNSPG 404
gi 19713512  319 VLLSEQNTVSKTNPYSREKLTTILAFYVEENAEKACERAIELLENEGEGHTLIIHSEDKDIIREFALRKPVSRMLINVGG 398
gi 28203558  324 VLIGKQNGVGNGNPLSFEKLTTVLAFYTVKDWHEACELSIELLQN-GIGHTMSIHTQNDDIVMEFA-KKPASRILVNTGG 401
gi 489858135 324 VLIAEETKVGAKIPYSREKLAPILAFYTAETWQEACELSMDILYHEGAGHTLIIHSEDKEIIREFALKKPVSRLLVNTPG 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144562  405 ALGGIGATINLVPALTLGCGAVGGSSTSHNIGPLDLMNTRNVAYGIRELEDIR-ELAVgatkevSASLDLG--------- 474
gi 19713512  399 SLGGVGATTNLAPAFTLGCGAVGGSSTSDNITPMNLINIRRVAVGVRELSDFKkDTNT------SSNLDVI--------- 463
gi 28203558  402 SQGGTGASTGLKPAFTLGCGTWGGSSVSENVTPEHLINKKRVAYGLKDCATLVqNDPTfnciktASNCRGVknqfmnmsp 481
gi 489858135 404 ALGGIGATTNLVPALTLGCGAVGGSSSSDNIGPENLFNIRRIATGVLELEDIRkEENQ------ATPELSV--------- 468
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*...
gi 18144562  475 ------------------------------DKEelINLLVKKIIEELK 492
gi 19713512  464 ------------------------------NSE--VEDMIRRIIAEYR 479
gi 28203558  482 aqiaaaaevlnkcndyakntgcsneskekdANNeeLLSLVNQIVAAMK 529
gi 489858135 469 ------------------------------DADalIQSLVEKVLAELK 486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap