Conserved Protein Domain Family
eut_PduT

?
TIGR02526: eut_PduT 
PduT-like ethanolamine utilization protein
This gene shows up in ethanolamine utilization operons in which a proteinaceous coat organelle is also encoded. It is closely related to the PduT protein in propane-diol operons with the same structure.
Statistics
?
PSSM-Id: 131578
View PSSM: TIGR02526
Aligned: 3 rows
Threshold Bit Score: 254.804
Threshold Setting Gi: 28204218
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144568    1 MKKSIGALEFRSISKGIEVSNEVVKKAFVEVSYLKSICPGKFFLIVNGDAGEVKEAIEFGEKLGEKYLVGSFIINSIHHD 80
gi 28204218    6 MKKALGLLEFNSISKGIETSDVLLKAAFVEVEILRQICPGKFLTIISGDVEEVKEAIDKAKSKDNKKLVESNIITSVHED 85
gi 489817766   2 AEQSLGILELRSISKGYEMADVFLKAGNVTLFTFRPTCPGKFLIILQGASGELTSAMQDAKEEAGKFHVSSYILHMAHEE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144568   81 IINALKGKYSQKniEDKAIGIMETGKVSSGILALDKTLKSSEVNLVKLQLAFGIGGKLVYIVSGDLSSVENGMREGQSIL 160
gi 28204218   86 ILKALKKRPIIK--EFNAIGVMEFSTVTSSLVALDIALKTSDIQLVKLVLGNGIAGKAYFIINGSVSSVEEGVKSAQNCV 163
gi 489817766  82 LLAFLNNK--HPkvEVDAVGIIEISQLGAGLNAVNEALKKSAIHLKRMTLGASIGGKFVAVFTGEVSAIQEGMRILIETA 159
                        170       180
                 ....*....|....*....|..
gi 18144568  161 QEKDIINVSIIPFVHSEIAKNL 182
gi 28204218  164 NSKRIVHSTVIPSPSKILLQNI 185
gi 489817766 160 EPKKVIHHTVIPSPDELLKRYL 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap