Conserved Protein Domain Family
type_II_gspE

?
TIGR02533: type_II_gspE 
type II secretion system protein E
This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131585
View PSSM: TIGR02533
Aligned: 9 rows
Threshold Bit Score: 755.755
Threshold Setting Gi: 13421293
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355   23 ARLLPYGFAKA-GQILIAHQHADTLEVWISERTSSAALAEVA-RNFG-AISLQRMPADELAQAINHAYARQDGSAAQIVG 99
gi 585224     14 IRRLPFSFANRfKLVLDWNEDFSQASIYYLAPLSMEALVETK-RVVKhAFQLIELSQAEFESKLTQVYQRDSSEARQLME 92
gi 13421293    3 TPMLAYGFAKRnGVVLLSLG--ERAVIGVREGYDPMALVEIR-RAVGaPLAIEPMTAPVFDRKFSEVYAGAGLATASSAD 79
gi 39575306   77 IRDLPINYAKQ-HNVLPYKEDADLLIVLTSNPVNLKALDDMK-VLFGkRVRPLITTSSRVQDAINKVYEKSTANLSG-LD 153
gi 39982200   26 LARLPLAFARG-RLVLPLRERDGRLLVVSGNPADLSAIDEVR-GVYGmEVELAAATPDTVLGAVNHLYARLGSSAQEVVE 103
gi 28056722   99 VHGLSIRFLKQ-FHVCPLAEHDGVLQLCVADPFDVYAIEALR-LATGaVLQLCIGLRSEIDDLVERWYGQGRSVMGMIVE 176
gi 488003489   5 FLQIPLKLIQK-SRIVPFSLSKKTIRIAVSDPSDLHPMDDARnFLKGyNVEFILAPEPEIMRIIHSHFDNTSSAAKEMLN 83
gi 499871850 111 VKRIPINFAKQ-SRILPLSLEGDTVAVAVADPLDTAALDHVR-VLLGqSVSQRIALGSTITDAINSVYDRSVNETEQLVD 188
gi 499373472   2 TTQLPYAWAKS-QRILLRHTEQG-AVLLVCPSTPGWSISEAR-RQFG-PARLERIRDEELDGLLATAYADTGSAAAVVG- 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355  100 EVEGEV-D-LSRLMQDIPEvEDLLEsEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRVDGTLRDVVRPKKAL 177
gi 585224     93 DIGADS-DdFFSLAEELPQnEDLLEsEDDAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKL 171
gi 13421293   80 SLDLEG-G-LGLLLEDMPAaADLLDpQDDAPVIRLINGLIAEAVRLGASDIHIEPFEKALIVRLRIDGVLTEVLSLSPRI 157
gi 39575306  154 EIAEED-Yd-----LDDPIvDLLEAgEDDAPVIKMVNSLLFRAVKEKASDIHIEPYEKDMAVRFRTDGILFDVFKPPKKL 227
gi 39982200  104 ELEGED-LsVIATELAEPK-DLLDL-TDEAPVIRLLNSILSEAVKERASDIHIEPYERELEVRFRIDGILYRKLAPPKVV 180
gi 28056722  177 ATDGDA-A-------PTDDiEALRDlASEAPVIRLVNLVIQRAVELRASDIHIEPFENRLKVRYRVDGVLIDAESPPSKL 248
gi 488003489  84 EMEG------SFSELAEAFeNETLDlSDDAPIIKMVNVILSQAVNERASDIHIEPYEKSLVVRYRVDGILHNVLSPPKSY 157
gi 499871850 189 EMETQDlD-AIAHELDEPK--DLLDeDDEAPVIRLVNSVLFRAAKERASDIHIEPMERELLVRFRVDGVLQEVIKPPKRY 265
gi 499373472  77 AAENEV-D-LDRLMQDMPEiTDLLDtQDGAPVIRMINALLTQAARDEASDIHIEPFETHSVVRYRVDGTLRDVVSPRKAL 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355  178 HGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPTGHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDK 257
gi 585224    172 SSLLVSRVKVMAKLDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRR 251
gi 13421293  158 AAMLVSRVKVMAKLDIAEKRVPQDGRISLALGGKSLDVRVSTLPARMGERVVMRILDKDQAGLRLSDLGMSPDVLSALET 237
gi 39575306  228 QNAITSRIKVMANLNIAEKRLPQDGRIPLKVGGKDIDIRLSCVPTTFGERLVMRIQDRSSVVRELAALGFSQDNLSRMEE 307
gi 39982200  181 QEALVSRVKIMAGLNIAEKRLPQDGRIRVIVAGRDVDIRVSIIPTFFGERVVLRLLDKQKGLISLENIGLSEGGVRSMER 260
gi 28056722  249 AAAVVSRVKIMAKLNIAERRLPQDGRIMLRVQGKELDLRVSVVPTSHGESVVMRLLDRETVVFDFQKLGFTDELLNRFSR 328
gi 488003489 158 HAGISSRIKIMSNLNIAENRLPQDGRIKLRLAGKDIDIRVSTIPCQFGERIVMRLLNKTDQKYSLDTMGFYPELIQSLRS 237
gi 499871850 266 QNAIVSRVKVMGQLNIAEKRLPQDGRIRIKLAGRDIDIRLSTIPTSFGERIVMRLLDKTATLLDLAEIGMSQKTLESMEA 345
gi 499373472 155 HGALVSRIKIMAQLDIAEKRLPQDGRIALRVAGRPIDIRVSTVPTGHGERVVMRLLDKQAGRLQLETLGMDPELLARLDT 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355  258 -LISRPHGIVLVTGPTGSGKTTTLYASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDII 336
gi 585224    252 -LIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVV 330
gi 13421293  238 -AVREPHGIILVTGPTGSGKTTTLYAALAVLNDNSRNILTIEDPVEYAVHGIGQTQVNTKVGMTFAAGLRAILRQDPDVV 316
gi 39575306  308 dILTRSYGIFLVTGPTGSGKSTTLYGALSKLNQPDVNILTVEDPVEQRIHGIGQVQVNSKIGLTFAAGLRSFLRQDPDII 387
gi 39982200  261 -LLGRTSGIILVTGPTGSGKSTTLYAALNRLNSPEKNIITIEDPIEYQVKGIGQIQVNPKIELTFAQGLRAILRQDPDIV 339
gi 28056722  329 -VLEMPHGILLVTGPTGSGKTTTLYTVLNRLNTTGVKIITVEDPVEYQIEGINQIQAKPQIGLDFASALRSIVRQDPDII 407
gi 488003489 238 -LIYEPHGIILVTGPTGSGKSTTLYSALSELNTEERNIITCEDPVEYQIEGISQMQMQEKIGLTFATGLRAILRQDPDVI 316
gi 499871850 346 -VIKRSHGIILVTGPTGSGKTTTLYGALSKINTPDLNILTVEDPVEYQLKGIGQMAISPKIGLTFAQGLRSFLRQDPDVI 424
gi 499373472 235 -LIRQPHGIVLVTGPTGSGKTTSLYAALARLDASTSNILTVEDPVEYDLPGISQIQVNAKIDMTFALALRAILRQDPDII 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355  337 MIGEIRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLVRQLCPACKEERHEGGRA 416
gi 585224    331 MVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQ 410
gi 13421293  317 MVGEIRDSETAQIAVQASLTGHLVLSTVHTNDAAGAVVRLRDMGVEPFLLASTLRLVIAQRLVRRLCEHCRTPEPADAAT 396
gi 39575306  388 MVGEIRDLETAELAIQASLTGHLVLSTLHTNDSAGAFPRLIDFGVEPFLIATSITGVIAQRLVRVLCPHCKAPHEATDFE 467
gi 39982200  340 MVGEIRDAETAEIAMQASLTGHLVLSTLHTNDSATAIARLVDMGIEPFMVASSLSAVLAQRLVRRICPHCRESYTP---E 416
gi 28056722  408 MIGEMRDLETARIAIQSALTGHLVLSTLHTNSAAGGLTRLLDMGVEDYLLTSTINGVLAQRLVRRLEPMHAERYLASPEQ 487
gi 488003489 317 MVGEIRDEETARIAIQASLTGHLVFSTLHTNDAASAATRLIDMGIEPYLITSTVLGFMAQRLVRVICTQCKETYKPTTSE 396
gi 499871850 425 MVGEIRDKETAEIAIQASLTGHLVLSTVHTNDAAGAVTRLVDMGVEPFLVASSLTGILAQRLVRRVCPDCRVPFEPTDAE 504
gi 499373472 314 MIGEIRDLETAQIAVQASLTGHLVLATLHTNDAVSAVNRLIDMGVEPFLLASSMLGVLAQRLVRRLCSQCKEQDPANPGT 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52427355  417 -------------------VWHPVGCDKCGHSGYTGRRGVYELLVIDDSIRSLIHRNAADAEILATGRAnGMRTLRDDAE 477
gi 585224    411 rklfdsk------kkepliLYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRA-TTPSIRDDGL 483
gi 13421293  397 aalvgl--------pegeiLYRPVGCAHCGHTGYQGRIGVYEALRVDDHLRRLIGGNASEQEITEAG---LDRRLGQEAR 465
gi 39575306  468 iqllgitr----eeankanICKAMGCNHCSQKGYSGRTNIGELLIVTDDIRSLIMQRKDGNTIKRQAVAnGMKTFRDHGI 543
gi 39982200  417 rdyagi--------tlpstLYRGRGCDACFGLGTLGRVGIYELLPVDGEICSMIIRREPAGAIKEYAVGkGMRTLRDDGL 488
gi 28056722  488 iarfdlrr---lqpegdiyLYRPR-ASALAPTGYLGRTAIVEFLIMDDALRRAVISRTGIGELEQIARQaGMRTMYEDGL 563
gi 488003489 397 lesigisk----kflkngnLHRGKGCSHCMGTGFKGRIGIYELLLVNSPLKQAILHGKDAGQLNEIALEhGFRTLKDYGI 472
gi 499871850 505 lkelghsvasfkqrygvdrIYKASGCPSCNRNGYRGRTGIYEFLPVDDDVRQLVLKNVDASTIKRSATSkGMTTLLDDGA 584
gi 499373472 394 --------------------WRPVGCPACNHIGYSGRTGIHELFCIDDDVRSLIHQGAEEQALRAAARRaGMFSMREDGE 453
                        490
                 ....*....|....*..
gi 52427355  478 RWLAAGATSLEEVLRVT 494
gi 585224    484 DKVRQGITSLEEVMRVT 500
gi 13421293  466 NYVLAGLTTVEEALRIT 482
gi 39575306  544 QKVLAGITTIEELTSNT 560
gi 39982200  489 AKAAAGITTIEEVLRVT 505
gi 28056722  564 IKALAGETTIEEVLRVT 580
gi 488003489 473 RKVVDGVTTIDEVLRVT 489
gi 499871850 585 RKIALGETTIAEVLSIT 601
gi 499373472 454 RWVRSGATAPEEILRVT 470
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap