2P31,3CYN


Conserved Protein Domain Family
gpx7

?
TIGR02540: gpx7 
Click on image for an interactive view with Cn3D
putative glutathione peroxidase Gpx7
This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Statistics
?
PSSM-Id: 131592
View PSSM: TIGR02540
Aligned: 9 rows
Threshold Bit Score: 305.992
Threshold Setting Gi: 28278471
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P31_A       28 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESF 107
gi 20810223  46 SFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESF 125
gi 47507404  46 DFYSYEVTDAKGRAVALSKYRGKASLVVNVASGCPHAEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNQEIGAL 125
gi 28278471  47 DFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAF 126
gi 33516901  24 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESF 103
gi 33516902  23 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENF 102
gi 52139038  21 DFYTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSHYKALQQLQRDLGSHHFNVLAFPCNQFGQQEPNSDREIENF 100
gi 18044310  46 SFYSFEVKDAKGRTVSLEKFKGKASLVVNVASDCRFTDKSYQILRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESF 125
3CYN_A       26 SFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESF 105
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
2P31_A      108 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALV 180
gi 20810223 126 ARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALV 198
gi 47507404 126 AKRNYGVTFPMFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKYWRPDETAESIRPEVASLV 198
gi 28278471 127 AKSNYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKIPRWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLV 199
gi 33516901 104 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALV 176
gi 33516902 103 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQV 175
gi 52139038 101 VRKNYSASFPMFSKTAVTGSGANTAFKYLIESSGKEPDWNFWKYLVGPEGKVVDAWGPTVSVAEVRPHITSLV 173
gi 18044310 126 ARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMI 198
3CYN_A      106 ARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALV 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap