Conserved Protein Domain Family
PrgH

?
TIGR02554: PrgH 
type III secretion system protein PrgH/EprH
In Samonella, this gene is part of a four-gene operon PrgHIJK and in general is found in type III secretion operons. PrgH has been shown to be required for secretion, as well as being a structural component of the needle complex. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131605
View PSSM: TIGR02554
Aligned: 3 rows
Threshold Bit Score: 553.365
Threshold Setting Gi: 52422293
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52422293    5 DSGLEALQLRILFGPLFGSDIAIPSGEVFFCVGEQVIDDRPAEHPenraghllERAVDTLYIPHRAGAPNFRLRFPgapt 84
gi 446372334   9 ITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLP--------DIPADSFFIPLDHGGVNFEIQVD---- 76
gi 499448506   6 TSGRDAVVVRLLNSPLRGCEFTLQPGKTLFLVGPESALAADGLPP--------ELPADSLFVPLAEGGVNFELLLD---- 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52422293   85 qaartaetgeAASGDFEVDFLSADGCVTQRAAFNTVCRFGDLAFALRRQREPWSEAVMHYAPHAPSRAADAAEPGapgep 164
gi 446372334  77 ----------TDATEIILHELKEGNPESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNG----- 141
gi 499448506  74 ----------NGCAR--LRILGDEVTES-EAPFNQPLSVGALRLALRPQHLPWQAEILNGFEPTGAPAAPSSATPgra-- 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52422293  165 gdggerasrFALKLGALLVAGVALAALAYWQVQryvGAQKLASVNGVLAGAPVPNAILPGDDGRIYVLSASQDGAEWDRE 244
gi 446372334 142 ---------IVAALAGFFILGIGTVGTLWILNS---PQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQ 209
gi 499448506 139 -------grALLALGALCAVALLAAGGHWLWNS---QQRQVAELSALLGDDGQRFHVLPGRDGVYYVAAADARDGVWARQ 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52422293  245 ALLKAALPEKIEVAVIGAERQRVERRLDEAG--VDFVTVRLDAPEHPELILTG---AAPAAARARAIGELRRAAPYVRDV 319
gi 446372334 210 VLARGDYDKNARVINENEENKRISTWLDTYYpqLAYYRLHFDEPRKPVFWLSRqrnTMSKKELEVLSQKLRALMPYADSV 289
gi 499448506 209 SLLRAEFRQPVQIVEPAGESERVSRWLSESRpeLAFYRLLLDDPRRPQLWISRqrsPLDEASRQKLASQLSVLMPYAERV 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52422293  320 RVIDASLGAIEQEARNALDKVGARYRLLARRGGATFEVASSFGDEELAALQNLMRSFGHKWGTRRVDFKIALRTDWLKGK 399
gi 446372334 290 NITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGR 369
gi 499448506 289 SIVPVDDEAASRQAEEGLSRQALPFTRNDQRDSVTFVIAGALDDGELQRARQFVDAYYRQWGGRYVQFAIELKDDWLKGK 368
                        410       420
                 ....*....|....*....|...
gi 52422293  400 SYREGGDGYVLLDHASWYFPQPL 422
gi 446372334 370 SFQYGAEGYIKMSPGHWYFPSPL 392
gi 499448506 369 SFKYGSQGYVKLNSGHWYFPKPL 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap