Conserved Protein Domain Family
YscW

?
TIGR02567: YscW 
type III secretion system chaperone YscW
This family of proteins is found within type III secretion operons. The protein has been characterized as a chaperone for the outer membrane pore component YscC (TIGR02516). YscW is a lipoprotein which is itself localized to the outer membrane and, it is believed, facilitates the oligomerization and localization of YscC.
Statistics
?
PSSM-Id: 131618
View PSSM: TIGR02567
Aligned: 4 rows
Threshold Bit Score: 156.156
Threshold Setting Gi: 12644658
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28806692    8 GLIGLMLLTGCAQsvgtsQPFSVQSQANVYGWISVEgYHPPVSTYIEVEMCQDFENQCLTVASQQYQGVQLPVQYSFLIA 87
gi 36787048    6 LVLLCLLMTGCVS-----EAIEHEASRLIEGDVTMR-ASLPRTANVEVSLLTVVEGKVLTVGEMHYRLDMLPVTFSMRLN 79
gi 12644658    2 LLPLALLLGGCVS-----QPAPMSPKVTVGGSVGGV-SLQARQAQLRLRLYAVVQGRMQTIAERRYRVSGLPLRYAFDLE 75
gi 488151319   6 ALIISFLLVGCAT-----PPMPAQR---IVGEVRMS-RPLSRIAHIDVSMFGLYEGKVREVQRTHFETGNLPLFFSIKLN 76
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 28806692   88 PiQAGKGEMKVIGKLYSQGQIIAQNEQKYIFREGsQKVDLRLFPIEIETKK 138
gi 36787048   80 P-QFSHGELFLRARLRWDGKRAVQAKSQQRIIAG-KRIVVQLSPLPCYPEC 128
gi 12644658   76 VdRLEGEALYLRTELSWVGVAAVQASAWQQVAAG-VDERVRLVRRDCFPNC 125
gi 488151319  77 PaQRGEGELYLRSTLSFP-ERGVQAVAQQKLTGK-NKVVLQMIPKTCYPNC 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap