Conserved Protein Domain Family
ComEB

?
TIGR02571: ComEB 
ComE operon protein 2
This protein is found in the ComE operon for "late competence" as characterized in B. subtilis. Proteins in this family contain homology to a cytidine/deoxycytidine deaminase domain family (pfam00383), and may carry out this activity.
Statistics
?
PSSM-Id: 131622
View PSSM: TIGR02571
Aligned: 4 rows
Threshold Bit Score: 296.385
Threshold Setting Gi: 27315739
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49332924    2 ERISWDQYFMTQSHLLSLRSTCTRLAVGATIVRDKRIIAGGYNGSIKGGVHCIDDGCYVIDNHCVRTIHAEMNALLQCAK 81
gi 27315739    2 ERIKWEEYFMAQSHLLALRSTCKRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLIEDGHCIRTIHAEMNALLQCAK 81
gi 28271586    5 QRIPWDQYFMMQAVLLASRSTCERLSVGATIVRDKRIIAGGYNGSVSGDVHCIDEGCYLVDGHCVRTIHAEMNAILQCAK 84
gi 489863319   2 QRIAWDQFFMAQSHLISSRSTCTRLMVGATIVRDKRIIAGGYNGSIAGGDHCAEHGCYVVDGHCIRTIHAEMNAILQCAK 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 49332924   82 FGVKTEEAEIYVTHFPCLQCCKAIIQSGITAVYYAQDYKNHPYAVELFEKANVTVKHVPLEYDIAALEDQK 152
gi 27315739   82 QGVSTEGATIYVTHFPCLNCTKSIIQAGIKTIYYAQDYHNNDYAIKLLKQSGIEYKKIPFSPEYVAQYLTQ 152
gi 28271586   85 FGAATDGAEIYVTDFPCLQCTKMLLQAGIQKIHYLRNYHNDAYAMSLIERKHVALQQVQFDQSDLDKLNLD 155
gi 489863319  82 FGASTDKAELYVTHFPCLACTKSIIQAGIKKVYFAKDYKNHPYALELFNIAGVELQKVEFDESVLQVNNWN 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap