Conserved Protein Domain Family
LcrG_PcrG

?
TIGR02573: LcrG_PcrG 
type III secretion protein LcrG
This protein is found in type III secretion operons, along with LcrR, H and V. Also known as PcrG in Pseudomonas, the protein is believed to make a 1:1 complex with PcrV (LcrV). Mutants of LcrG cause premature secretion of effector proteins into the medium .
Statistics
?
PSSM-Id: 131624
View PSSM: TIGR02573
Aligned: 4 rows
Threshold Bit Score: 103.69
Threshold Setting Gi: 403246915
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28806651   2 KQPFTQAIENAELAIRNADERNDIFSELLEGLGVGPVAGEVLLGGLNAspKLMQHAEQELIEEVQRRRQQQHQlQGVQGK 81
gi 126025     6 FDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVMKIFAGRSA--EEIKPAERELLDEIKRQRERQPQ-HPYDGK 82
gi 36787056   3 EEPNAKVLQAAEAAIKDSDHRLQLLQEMWQSLGINPNVGTELFGHTDV--TLVQNAEQELLTEVNRLRSNQPP-SLEEGK 79
gi 489211543  9 EDTLRATVQAAELAIRDSEERGRLLAEMWQGLGLAADAGELLFQAPER--ELARAAEEELLAELRRMRSSQPT-QGEQGT 85
                        90
                ....*....|...
gi 28806651  82 RRKRPTMMRGMVI 94
gi 126025    83 RPRKPTMMRGQII 95
gi 36787056  80 RLRRPPRMRGIIV 92
gi 489211543 86 RPRRPTPMRGLLI 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap