Conserved Protein Domain Family
cas_Cas5h

?
TIGR02592: cas_Cas5h 
CRISPR-associated protein Cas5, subtype I-B/HMARI
This is a CRISPR-associated protein unique to the hmari subtype of cas genes and CRISPR repeat, which is the only subtype present in Haloarcula marismortui ATCC 43049. The hmari type, though uncommon, is also found in the Aquificae, Thermotogae, Firmicutes, and Dictyoglomi.
Statistics
?
PSSM-Id: 131641
View PSSM: TIGR02592
Aligned: 4 rows
Threshold Bit Score: 296.404
Threshold Setting Gi: 403253266
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28203582    2 DALKFSLSGRTAFFKKPDVnSFFYFTYGNVHKVALLGILGAICGYGgynsqclnKEQIYPEFYekLKDINIGVVPKNEKG 81
gi 20904947    2 DCLVFRAKSGYAKFRKPYT-TTSALTFLCIHPPAVKGLIGAVLGID--------KTEIYRNTL--DLKIGIQVLSPVRKD 70
gi 55229000   20 RCLSLTVRGPWGHFRRVEG-NVVKQTYRVMPRTTVAGLIAAVLGIE--------RDGYYDLFApgRSAIAIEPVRGLRTL 90
gi 495469731   5 KVLVFDVSAPYALFRRPYT-TTSSYTLPFPPRTTLLGLVGCVLGYS--------TPERLDS-----AKVAVQIKNPLKFL 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28203582   82 YIDKKIQVFNNSvgy-----------asKELGGnLIVKEQWLENPKWAIYILMDE-NVPKDLKDRLLNFKFKYIPYLGKN 149
gi 20904947   71 MQVLKLVSMKAE----------------KDLFN-FPVNAEFLRDPEYRIFVSWLP-DKLDELEDRLQNQMPIFTPYLGVS 132
gi 55229000   91 NMPVNALSTAADnlkslnsrgklsvklpDPMDLrQQHNYEVLVDPAYRIDVALADsETYRELRQTLEAGRSHYVPSLGLS 170
gi 495469731  71 RTGTNFVETKKD----------------KKASKrTRISLQLLKNPAYRVFFSWED-EDFERLKNLLEHSETIFTPYLGVA 133
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28203582  150 DHMANITDVEYLENIEkLDNT-NKLDSIFIKDKyeIQKESKNFNDLKNIIKKSSSKIQEFKYEEMLPISLEETTNKYNLE 228
gi 20904947  133 EYIAKLDYEKRVNAEL-LTKS-SSIDSLVPSRF--IDLQHSDYHIFTDNIPVSNNEKREYISYEKILFAFREDDTCKKEI 208
gi 55229000  171 EHLANISFHGEFTIEEgPDDTvVSVDSTLPNAVddVVLDSDTRCGIEESPAFMTTDAGGRTTTAFTTYAYNPDAEPLRVR 250
gi 495469731 134 SFIARLNYVGKYEATR-VADFpCEVHTVVPNTV--KLLPEPSHYLIFERVTRKMDKER--NMLESAVYIFKRDLSPVKVE 208
                        250       260
                 ....*....|....*....|....*...
gi 28203582  229 TFIYTNSnlkplADTKTYKCGDKNIFFF 256
gi 20904947  209 ACSLMGN-----LKRDVYKVDENIVFFF 231
gi 55229000  251 NMQ-------------PSRVDGRTVVFV 265
gi 495469731 209 GG-------------EVWRVGEQNIVWM 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap