Conserved Protein Domain Family
PHA_gran_rgn

?
TIGR02610: PHA_gran_rgn 
putative polyhydroxyalkanoic acid system protein
All members of this family are encoded by genes polyhydroxyalkanoic acid (PHA) biosynthesis and utilization genes, including proteins at found at the surface of PHA granules. Examples so far are found in the Pseudomonales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.
Statistics
?
PSSM-Id: 131659
View PSSM: TIGR02610
Aligned: 3 rows
Threshold Bit Score: 138.914
Threshold Setting Gi: 70733932
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24986787   21 MTQISVERKHSLGRDAARAKAEALVDKLSREYDLKATWNGDRVDVARSGANGSVHIGDDSIRVELKLGMMLSMMSGTIKG 100
gi 21112667    1 MSSIDIRHDHSRTPAQARAAIEDAARKLTDRYGIASHWEGDTLRIARAGVDGAINLLPQQVQVTAELGFLLSAMQPMVES 80
gi 499371225   1 MARISVERAHGLGKQAAREKADKLAQKLADQYGLEPQWAGDTLNLKRSGVKGAVHVGEESIRIDVELGMLMSAMSGTIKS 80
                         90
                 ....*....|.
gi 24986787  101 EIERALDKALA 111
gi 21112667   81 EIRRLLAEKLA 91
gi 499371225  81 EIEKALDKALV 91
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap