Conserved Protein Domain Family
TIGR02611

?
TIGR02611: TIGR02611 
TIGR02611 family protein
Members of this family are Actinobacterial putative proteins of about 150 amino acids in length with three apparent transmembrane helix and an unusual motif with consensus sequence PGPGW. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131660
View PSSM: TIGR02611
Aligned: 5 rows
Threshold Bit Score: 129.496
Threshold Setting Gi: 6822236
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38199421    8 VADHLERLNRHHENL-----KHTRYGFIVRPLVLTLGWIVVVVGIITIPFPGPGWLTVFIGIAILSLELHWASNLLAWGV 82
gi 23492413   29 VQDRIERLQDAHERS-----KKKKYGFLVRPATLILGWVVMIIGLITIPLPGQGWLTTFIGVGILSLEQNWAKRLLGWGV 103
gi 38199918    5 VHNLMNKMQDRHLHM-----KAAWYGPVLSPLLLVAGMCLLIFGIIILPTPAPGWLCIFIALGILSLVHPPTRRLTIWLA 79
gi 6822236    25 AERALGSRAPEFVKA------RRALHLSWQVGVFVVGLAVVVAGIIMLPLPGPGWVVIFGGMAIWATEFVWAQLVLRWTK 98
gi 500047980   3 VKEKLSEYRDQWVHQrerlrKRPLANFVYRSVIGVVGTVVLAVGVVAIPYPGPGWAIVFLGLAILATEFRFAEVALRFIR 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 38199421   83 RLYDRFFSWYHVQSTRMRYSLIAATIVACWIVGGGIAIVMWKCGML 128
gi 23492413  104 HQYDRFFAWYATKSFRFRMLTMAVLLVLIWIVFAVTFWAMWIYGTL 149
gi 38199918   80 SKLDIFFAWYGQRHPAVRTSLVGLLILFMVLVMGGTYLFIAPAHWP 125
gi 6822236    99 RKVTEAAQRALDPRVRRRNIILTSIGVVIIAVLAGIYLWKFGLEMP 144
gi 500047980  83 RRYDEVMAWFARQHIAVKALSAGFTAAVVLATLWGLGALYWAGGLV 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap