Conserved Protein Domain Family
mob_myst_B

?
TIGR02613: mob_myst_B 
mobile mystery protein B
Members of this protein family, which we designate mobile mystery protein B, are found in mobization-related contexts more often than not, including within a CRISPR-associated gene region in Geobacter sulfurreducens PCA, and on plasmids in Agrobacterium tumefaciens and Coxiella burnetii, always together with mobile mystery protein A (TIGR02612), a member of the family of helix-turn-helix DNA binding proteins (pfam01381). This protein is encoded by the downstream member of the gene pair and belongs to the Fic protein family (pfam02661), where Fic (filamentation induced by cAMP) is a regulator of cell division. The characteristics of having a two-gene operon in a varied context and often on plasmids, with one member affecting cell division and the other able to bind DNA, suggests similarity to addiction modules.
Statistics
?
PSSM-Id: 131662
View PSSM: TIGR02613
Aligned: 4 rows
Threshold Bit Score: 311.769
Threshold Setting Gi: 14022680
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39983374    9 ATPLDSDEAEGLLLTHITSRGELDRWEQENIAEGEAWAFGRRQK---NILSEAFIRRLHKRMFGHVWRWAGEFRRSDKNI 85
gi 14022680   10 ATPLDPNELAGLKHRHITTQAELDELEQANITSGLLWLSRTRRK---DILSDGFAIELHRQLFGQVWNWAGAFRTTGKNI 86
gi 39575408    9 ATPLDDETLRGLIPG-LTTHGELDEFEAANIARAILWAESSRSLk-kDLLSLTGLKRLHQKMFEDTWRWAGDLRTRQTNI 86
gi 499281818  11 ATPLEPQEREGLLQSWITHRQDLNEAEQENIVEGAAWARGRRRMpvgRMLTEDFMRTLHRRMFGEVWQWAGSFRTTERNI 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39983374   86 GVTWWQVPIELRKLCDDVVAWIAFGTYPPDEIAVRFHHRLVAIHPFANGNGRHARTMTDLLLVQALqRPRFTWGSG-NLV 164
gi 14022680   87 GVDPAQIGSQLRVVLDDARYWADKGTYMPREAAVRLHHRIVFVHPFANGNGRHARILADAVLEKIYkVDPIDWTAGsDLQ 166
gi 39575408   87 GVSPLSIQSDMAILLGDISYWLQNQTFSVEEIAIRFHHRLVYIHPFPNGNGRCARLATDLFLKQQG-YSGFTWGRA-SLA 164
gi 499281818  91 GIQAYRIPVELAALLDDVRYWVQHETFAADEIAIRFHHRLVAIHPFPNGNGRHARLAADLLVEKLG-AEPFSWGSG-SLG 168
                        170       180       190
                 ....*....|....*....|....*....|
gi 39983374  165 SVGDCRRYYIEALRAADRH-DYQLLLEFVR 193
gi 14022680  167 KMNERRAGYIAALKAADRH-DITPLLAFVG 195
gi 39575408  165 LAGHLRKEYIRCLKLADKAgEYGPLLNFAK 194
gi 499281818 169 DVGDLRTRYVAALQAADNH-DIAPLLEFAR 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap