Conserved Protein Domain Family
spoVE

?
TIGR02615: spoVE 
stage V sporulation protein E
This model represents an exception within the members of the FtsW model TIGR02614. This exception occurs only in endospore-forming genera such as Bacillus, Geobacillus, and Oceanobacillus. Like FtsW, members are found in a peptidoglycan operon context, but in these genera they part of a larger set of paralogs (not just the pair FtsW and RodA) and are required specifically for sporulation, not for viability. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131664
View PSSM: TIGR02615
Aligned: 4 rows
Threshold Bit Score: 484.664
Threshold Setting Gi: 22777153
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134774     9 DLLLVIITLLLLTIGLIMVYSASAVWADYKFDDSFFFAKRQLLFAGIGVIAMFFIMNVDYWTWRTWSKLLMVICFFLLVL 88
gi 22777153  11 DYILLIILSILLMAGIVMVFSSSYIWSEYKFNDAFYYLKRQALFAGAGVAAMIFFMFIPYYTWKKYAKMILFICFILLLL 90
gi 28203731  13 DFLMFCVIMLLVAIGVVMVYSASSYFAFYKHEDSMYFLKRQGLWAILGIFCMFATINIDYHKYKRHTKMLMLITTVLLLV 92
gi 20516655   8 DYGILLVVMILVAIGVVMVFSASAATAEYMYNDPYYFLKRQLVWAILGFFAMVFTMNVDYLWFKRWAGAFLVISIVLLVL 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134774    89 VLIPGVGMVRNGSRSWIGVGAFSIQPSEFMKLAMIAFLAKFLSEKQKNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGT 168
gi 22777153  91 VLIPGVGMVRGGAQSWIGIGAFSIQPSEFMKLGLIIFLASLLSEYQKYITSLRKGFLPCLLLIFTAFGLIMLQPDLGTGM 170
gi 28203731  93 VFAF---TEVNGARRWIRLGPASFQPSEIAKYMVVIYLAKSIESKGERIRTFTYGVIPYLLVAGFYAGLVYAEKNLSIAT 169
gi 20516655  88 VLIPGIGVERYNATRWIGVGNFTVQPSEIAKYALIIYLAKYFDKHPEYAKSLKKGVIPVLGLAGVFFGLIMLQPNFSTAG 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134774   169 VMVGTCIVMIFVAGARIAHFVFLGLIGLSGFVGLVLSAPYRIK--RITSYLNPWEDPLGSGFQIIQSLYAVGPGGLFGMG 246
gi 22777153 171 VLVLTCMIMLFVAGANLSHFFGLAGIGVIGFIGLIASAPYRIN--RITAFLNPWEDPLGHGFQIIQSLYAIGPGGLMGLG 248
gi 28203731 170 VIMMVTFIILFVAGARFSHLIAIVIPVISAGVAAILLTPFRLG--RLLSFRNPWVDPKGKGYQLIQSFLALGSGGIWGVG 247
gi 20516655 168 IIFIVSVVMLFVAGAKLSYMGILLG--TGLGVAVLVISSFKYVreRVLTFLNPWQDIQKSGYQIVQSLYALGSGGLFGVG 245
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134774   247 LGQSRQKFFYLPEPQTDFIFAILSEELGFIGGTLILLLFSVLLWRGIRIALGAPDLYGSFVAVGIISMIAIQVMINIGVV 326
gi 22777153 249 LGNSLQKYFYLPEPQTDFIFAIIGEELGFIGGAMIIILFFLLLWRGIKIALEAPDLFSRLLAVGISSMLALQAMINISVV 328
gi 28203731 248 LGQSRQKCYYIPEPHNDFIFAVIGEELGLIGCTFIILLFVIFAWRGIVTAVKAKDTFGTLTAIGITSVIGVQALINIAVV 327
gi 20516655 246 LGNSRQKLMYLPMPHNDFIFSIIGEELGLVGTVTILLMFLYIILRGLRVAAKAPDMFGCLLATGITSLIGIQAFINVAVV 325
                       330       340       350
                ....*....|....*....|....*....|....*.
gi 134774   327 TGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSR 362
gi 22777153 329 IGLIPVTGITLPFLSYGGSSLTLTLCSVGILLNISR 364
gi 28203731 328 TGSIPVTGVPLPFISYGGSSLVLNMMAMGILLNISR 363
gi 20516655 326 TSSMPPTGVSLPFISYGGTSTLIMMAGVGILLNISR 361
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap