1GT7


Conserved Protein Domain Family
rhamnu_1P_ald

?
TIGR02624: rhamnu_1P_ald 
Click on image for an interactive view with Cn3D
rhamnulose-1-phosphate aldolase
Members of this family are the enzyme RhaD, rhamnulose-1-phosphate aldolase.
Statistics
?
PSSM-Id: 131673
View PSSM: TIGR02624
Aligned: 7 rows
Threshold Bit Score: 506.626
Threshold Setting Gi: 357528923
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GT7_A         1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDnFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR 80
gi 46577065    7 QQDVLDAPFMKEMMNTTYDMWKLGWDELNGGNISYLLKEEEVRSYFD-LNQVKRTISLDFPVIELANQYFLVTGSGKFFR 85
gi 46577091    2 TKDIMDAVFIKEMAKTTSNLYRLGWDERNGGNITYLLDEKEVAEYLD-VKQIIRTIPMDFDGKKLAGKYFLVTGSGKYFK 80
gi 46576999    1 -MNVLQAPFVEEMVKTTKNLYRLGWDERNGGNISYLLKEEEILPFLN-PTQVLRKIPMKFDATKLAGKYFIVTGSGKYFK 78
gi 46577097    1 MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPYRRdFYQQPRKVELTQPAPELANSWFLVTGSGKFFR 80
gi 357528923   3 MTDFIDSPYVRDMAQTTENLYRHGWDERNGGNVSLRLTKEEVEAYAG-TDKVLRQIPIKFDASELAGKYYLVTGTGRYFK 81
gi 417641      1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDnFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GT7_A        81 NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNgKDRVIMHCHATNLIALTYVLENDTAV 160
gi 46577065   86 KIIENPEECLAVLRVTSDGESVELLWGLSDGGRPTSELASHFMSHIVRLKHDP-NHRVIMHTHATNLIAMTFTHELDEVQ 164
gi 46577091   81 NVEEAPAVNLGVIQVSEDGKAVHLLWGYTDGGLPTSELPAHFMSHIARLSVDP-ENRVVMHCHATHLLAMTFTHELTERA 159
gi 46576999   79 NVCDASSENLGILRVSENGQELELLWGLEDEAVPTSELPSHFMSHIARLAVDP-ENRIVMHNHASHLLAMSFTHELDEKV 157
gi 46577097   81 NVELNPAENLVLLQVSNDGMAYHIHWGLTQGGLPTSELAAHFQSHIVRMQVSGgTNRVIMHCHATNLIALSYVQKLENAS 160
gi 357528923  82 NMVEFPERDMGLIRISEVGNSVDLMWGFNDGGEPTSEFPSHLMSHIARLKQDP-DQRVIMHCHPTNLVAMTFTIPLSSKR 160
gi 417641     81 NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNgKDRVIMHCHATNLIALTYVLENDTAV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GT7_A       161 FTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK 240
gi 46577065  165 FTRTLWQMCTECLVVFPEGVGILPWMVPGTSEIGKATAEKMNEYRLAIWSHHGIFGAGESIDQVFGLIETVEKAAKVYNL 244
gi 46577091  160 FTRTLWQMCTECLVVFPEGVGIIPWLVPGTNEIGEATSEKMKENRLIVWPHHGIYGAGQSMDETFGLIETAEKAAEVYTI 239
gi 46576999  158 FTRTLWQMCTECLVVFPDGVGIIPWLVPGTNEIGVATAEKMKESRLVLWPQHGIYGTGRDMDEVFGLIETAEKAAEVYTY 237
gi 46577097  161 FTRLLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLDDAFGLIDTAEKSAEIMVK 240
gi 357528923 161 FSRTLWKMHPESIVVFPEGVGVIPYMCPGTNEIGEKTAAKMADYRVVVWPHHGVFAAGDSLDETYGLVETVEKSALIYTT 240
gi 417641    161 FTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK 240
                        250       260       270
                 ....*....|....*....|....*....|...
1GT7_A       241 VYSM-GGMKQTISREELIALGKRFGVTPLASAL 272
gi 46577065  245 VNAHpDGAKQVITDQQLIDLAEAFHVNPPNKYF 277
gi 46577091  240 VMSQ-GGIKQAITDEQLKALGERFGVEAKAGYL 271
gi 46576999  238 VCAQ-GGVRQTISDADLWRLAEAFGVTPKVGYL 269
gi 46577097  241 VLSM-GGKKQTISREQLIALAARFDVTPMAAAL 272
gi 357528923 241 IREQgGEVLQSLTDKDFRDLIKRFDLKANEDFL 273
gi 417641    241 VYSM-GGMKQTISREELIALGKRFGVTPLASAL 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap