1X8D


Conserved Protein Domain Family
YiiL_rotase

?
TIGR02625: YiiL_rotase 
Click on image for an interactive view with Cn3D
L-rhamnose mutarotase
Members of this protein family are rhamnose mutarotase from Escherichia coli, previously designated YiiL as an uncharacterized protein, and close homologs also associated with rhamnose dissimilation operons in other bacterial genomes. Mutarotase is a term for an epimerase that changes optical activity. This enzyme was shown experimentally to interconvert alpha and beta stereoisomers of the pyranose form of L-rhamnose. The crystal structure of this small (104 amino acid) protein shows a locally asymmetric dimer with active site residues of His, Tyr, and Trp. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 131674
View PSSM: TIGR02625
Aligned: 8 rows
Threshold Bit Score: 183.098
Threshold Setting Gi: 16804883
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1X8D_A         3 RKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTD 82
gi 418498      3 RKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTD 82
gi 49609914    3 RKAFVMSVFPDSHDEYQRRHNPIWPELAEVLKNHGAHHYSIFLDKQRNLLFGYVEVESEARWEAIAQTDVCQRWWKHMGD 82
gi 52308431   18 RKGFVMQVNPDCHAEYKKRHDEIFPELVEELKSHGAHHYSIFLDKQRNLLFGYVEIENEQRWNDVAKTAACRKWWAFMRD 97
gi 22776172    3 RKGFIMTVYPDKHDEYEKRHNEIWPEMVAELKKHGAHNYSIFLDKQTNQLFGYIEIEDEEKWSKMAETSINQKWWKFMKP 82
gi 28272742    3 RLGQVMYLHKDAYEEYAKRHAELWPEMKTALKKYGATNYSIFLNKLTGQTFAYLEVPDEATYNEIAETDICKKWWKYMEP 82
gi 497599286   3 RVASIMYLYPGNKEEYKKRHDELWPEMKEALKAHGAANYSIFLDEKTDTLFAYVEVEDKAIYDKIAETEICQKWWKYMAP 82
gi 45435191    4 RKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIFLDETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMAD 83
                         90       100
                 ....*....|....*....|..
1X8D_A        83 VMPANPDNSPVSSELQEVFYLP 104
gi 418498     83 VMPANPDNSPVSSELQEVFYLP 104
gi 49609914   83 VMPSNPDNSPISDALDPVFYLD 104
gi 52308431   98 VMPSNPDNSPVSQELEQVFYLD 119
gi 22776172   83 VMKTNSDDSPVSTDLTEVFHMD 104
gi 28272742   83 LMDTNEDNSPVTTDLQEVFHLD 104
gi 497599286  83 IMKSNPNNSPVAVDLKEVFYLA 104
gi 45435191   84 VMPSHPDNSPVSQALREVFYLE 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap