2HCV


Conserved Protein Domain Family
L_rham_iso_rhiz

?
TIGR02629: L_rham_iso_rhiz 
Click on image for an interactive view with Cn3D
L-rhamnose catabolism isomerase, Pseudomonas stutzeri subtype
Members of this family are isomerases in the pathway of L-rhamnose catabolism as found in Pseudomonas stutzeri and in a number of the Rhizobiales. This family differs from the L-rhamnose isomerases of Escherichia coli (see TIGR01748). This enzyme catalyzes the isomerization step in rhamnose catabolism. Genetic evidence in Rhizobium leguminosarum bv. trifolii suggests phosphorylation occurs first, then isomerization of the the phosphorylated sugar, but characterization of the recombinant enzyme from Pseudomonas
Statistics
?
PSSM-Id: 131677
View PSSM: TIGR02629
Aligned: 4 rows
Threshold Bit Score: 874.352
Threshold Setting Gi: 122920358
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HCV_A       10 VVARENDRRASALKEDYEALGANLARRGVDIEAVTAKVEKFFVAVPSWGVGTGGTRFARFPGTGEPRGIFDKLDDCAVIQ 89
gi 46091637  10 VVARENDRRASALKEDYEALGANLARRGVDIEAVTAKVEKFFVAVPSWGVGTGGTRFARFPGTGEPRGIFDKLDDCAVIQ 89
gi 20139627  10 VVEKNNAARKPDLERDYASLGERLDRRGIAIDAIRAKVEKFAVAIPSWGVGTGGTRFARFPGAGEPRDIFDKIEDCAVIS 89
gi 20139567   9 VLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGTGGTRFARFPGPGEPRNIFDKLEDCAVIQ 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HCV_A       90 QLTRATPNVSLHIPWDKA-DPKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYGSLSHTNAATRAQAVEHNLECIEIG 168
gi 46091637  90 QLTRATPNVSLHIPWDKA-DPKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYGSLSHTDAATRAQAVEHNLECIEIG 168
gi 20139627  90 QLTQATPTVSLHIPWDKA-DPNRLKQAASRFGLGFDAMNSNTFSDARDQKLSYKFGSLSHADAGTRRQAVEHNLECIEIG 168
gi 20139567  89 QLTRATPAVSLHIPWDKVsDLGALKEKGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIG 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HCV_A      169 KAIGSKALTVWIGDGSNFPGQSNFTRAFERYLSAMAEIYKGLPDDWKLFSEHKMYEPAFYSTVVQDWGTNYLIAQTLGPK 248
gi 46091637 169 KAIGSKALTVWIGDGSNFPGQSNFTRAFERYLSAMAEIYKGLPDDWKLFSEHKMYEPAFYSTVVQDWGTNYLIAQTLGPK 248
gi 20139627 169 KTLGSKALTVWIGDGSNFPGQVNFARAFERYLDAMKAVYAGLPADWKLFTEHKMYEPAFYSTVVQDWGTNYLIAKELGDR 248
gi 20139567 169 KALGSKALTVWVGDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYLIAQELGPK 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HCV_A      249 AQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDDLDAGAIEPYRLFLVFNELVDAEARGVKGFHPAHMIDQ 328
gi 46091637 249 AQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDDLDAGAIEPYRLFLVFNELVDAEARGVKGFHPAHMIDQ 328
gi 20139627 249 AFCLVDLGHHAPNVNIEMIVSRLIQFKKLGGFHFNDSKYGDDDLDAGSIDPYRLFLVFNELVDAELSGAEGFDPAHMLDQ 328
gi 20139567 249 AFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAANGFDPAHMLDQ 328
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HCV_A      329 SHNVTDPIESLINSANEIRRAYAQALLVDRAALSGYQEDNDALMATETLKRAYRTDVEPILAEARRRTGGAVDPVATYRA 408
gi 46091637 329 SHNVTDPIESLINSANEIRRAYAQALLVDRAALSGYQEDNDALMATETLKRAYRTDVEPILAEARRRTGGAVDPVATYRA 408
gi 20139627 329 SHNVTDPIESLMLSAVEVQRAYAQALLVDRKALEGFQDGNDALMATQTLKAAYRTDVEPILAMARLKTGGAIDPVATYRA 408
gi 20139567 329 SHNVTDPIESLMTSAMEVGRAYAQALIVDRKALAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRA 408
                       410
                ....*....|...
2HCV_A      409 SGYRARVAAERPA 421
gi 46091637 409 SGYRARVAAERPA 421
gi 20139627 409 AGYRAKVAAERPA 421
gi 20139567 409 SGYRARVAAERPA 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap