Conserved Protein Domain Family
xylG

?
TIGR02633: xylG 
D-xylose ABC transporter, ATP-binding protein
Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005). [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131681
View PSSM: TIGR02633
Aligned: 4 rows
Threshold Bit Score: 916.137
Threshold Setting Gi: 1175040
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040     3 LLEMKHITKKFGDVTALHNISIELEAGEILSLCGENGSGKSTLMKILCGIYPCGDYSGDIYFSESELKARNIRDTEEKGI 82
gi 586266      4 LLEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEIIFAGEEIQASHIRDTERKGI 83
gi 499652993   5 LLQMNGIVKTFGGVKALNGIDLKVRPGECVGLCGENGAGKSTLMKILSAVYPHGTWDGEILWDGQPLKAQSISETEAAGI 84
gi 497596508   5 LLTMRGIVKDFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVHPHGTWDGEIHWEGAPLVASGVRDTERAGI 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040    83 SIIHQELTLVKNMSVLENIFLGNEITHKG-LTADNEMYLRCKNLLQQVQLDADPNTR-VGELGLGQQQLVEIAKALNKQV 160
gi 586266     84 AIIHQELALVKELTVLENIFLGNEITHNG-IMDYDLMTLRCQKLLAQVSLSISPDTR-VGDLGLGQQQLVEIAKALNKQV 161
gi 499652993  85 VIIHQELTLVPDLSVAENIFMGHELTLPGgRMNYPAMIHRAEALMRELKVPDMNVSLpVSQYGGGYQQLVEIAKALNKQA 164
gi 497596508  85 VIIHQELMLVPELSVAENIFLGNEITLPGgRMHYAAMVRRAHELLRELRIDAINVARpVMDYGGGHQQLIEIAKALNKRA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040   161 RLLILDEPTASLTEKETEILLNLIKDLKAHNIACIYISHKLNEVKAISDKICVIRDGEHVGTKDASTMTEDDIITMMVGR 240
gi 586266    162 RLLILDEPTASLTEQETSILLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVGR 241
gi 499652993 165 RLLILDEPSSALTRSEIEVLLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGQHIATTAMENMDIPQIITQMVGR 244
gi 497596508 165 KLLILDEPSSSLTAAETQGLLDIVRDLKRRGVACVYISHKLEEVEAVCDTVTVIRDGRHVATEPMRALSTERIIAMMVGR 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040   241 EITSLYPHEPHEIKDEILRVENLSAWHPINTHIKRVDNVSFSLHEGEILGVAGLVGSGRTDMVQCLFGSYEGKFEGNIFI 320
gi 586266    242 ELTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYI 321
gi 499652993 245 EMSSLYPTEPHDIGEVIFEARHITCYDVDNPKRKRVDDVSFSLRRGEILGIAGLVGAGRTELVTALFGAYPGRHEGEVWL 324
gi 497596508 245 EIRNLYPREPHEIGDVVLEARNVTCHDVTNPRRKRVDDVSFSVRRGEILGVAGLVGAGRTELMQAIFGAYPGACAASVLM 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040   321 NQKQVNIKNCAQAIEHKIVMVPEDRKKHGIVSIMGVGKNITLSSLKSYCFgKMVVNEAKEEQIIGSAIKRLKVKTFSPDL 400
gi 586266    322 DGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGgISQLDDAAEQKCILESIQQLKVKTSSPDL 401
gi 499652993 325 DGHPIDTRTPLKSIRAGVCLVPEDRKRQGIIPDLGVGQNITLAVLDSFSK-LTRIDAEAELGSIDREISRLHLKTASPFL 403
gi 497596508 325 NGRPLAIRSPADAIRAGIAMVPEDRKRHGIVPQLGVGHNITLSVLQRFAT-RGRIDAAAELDAIRAGMQRLSVRAAHPFL 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175040   401 PIGRLSGGNQQKAILAKCLSLNPKILILDEPTRGIDVGAKYEIYKLINQLAQEGIAIIVISSELPEVLGISDRVLVMHQG 480
gi 586266    402 AIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEG 481
gi 499652993 404 PITSLSGGNQQKAVLAKMLLTRPRVLILDEPTRGVDVGAKYEIYKLMGMLAAEGVSIIMVSSELAEVLGVSDRVLVIGEG 483
gi 497596508 404 PIAGLSGGNQQKAVLTKMLLTDPQVLILDEPTRGVDVGAKAEIYRLVFALARRGVALVVVSSELAEVLGLADRVLVIGEG 483
                        490       500
                 ....*....|....*....|.
gi 1175040   481 KLKASLINTALTQEQVMETAL 501
gi 586266    482 KLKANLINHNLTQEQVMEAAL 502
gi 499652993 484 RLQGDFVNHELTQEQVLAAAL 504
gi 497596508 484 EVCGDFVNDGLTQEQILAAAL 504
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap