Conserved Protein Domain Family
gas_vesic_GvpN

?
TIGR02640: gas_vesic_GvpN 
gas vesicle protein GvpN
Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728). [Cellular processes, Other]
Statistics
?
PSSM-Id: 131688
View PSSM: TIGR02640
Aligned: 5 rows
Threshold Bit Score: 435.76
Threshold Setting Gi: 12230149
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3089529   15 FIQDDETKEVLSRALSYLKSGYSIHFTGPAGGGKTSLARALAKKRKRPVMLMHGNHELNNKDLIGDFTGYTSKKVIDQYV 94
gi 1708088   20 FVVTPAIERVAIRALRYLKSGFPVHLRGPAGTGKTTLAMHLANCLDRPVMLLFGDDQFKSSDLIGSESGYTHKKVLDNYI 99
gi 22095751  45 FVETEQVRDLTRRGLGFLNAGYPLHFRGPAGTGKTTLALHVAAQLGRPVIIITGDNELGTADLVGSQRGYHYRKVVDQFI 124
gi 12644478  64 FIETESVNRVESRMERWLDVGRPVHLIGPTGCGKTSLAMHVARERDRPVVWINGDAELTTSDLVGEYAEKERISEHDQFI 143
gi 12230149  62 FIETDAVARVTDRMRRWLSVDRPVHLIGPTGCGKTAVAMHVARTRDRPVVWVNGDADLTTSDLVGEYAETERISEHDQFI 141
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3089529   95 RSVYKKDEQVSENWQDGRLLEAVKNGYTLIYDEFTRSKPATNNIFLSILEEGVLPLYGVKMTDPFVRVHPDFRVIFTSNP 174
gi 1708088  100 HSVVKLEDEFKQNWVDSRLTLACREGFTLVYDEFNRSRPEVNNVLLSALEEKILSLPPSSNQPEYLSVNPQFRVIFTSNP 179
gi 22095751 125 HNVTKLEETANQHWTDHRLTTACREGFTLVYDEFTRSRPETHNVLLGVFEERMLFLPAQAREECYIKVHPEFRAIFTSNP 204
gi 12644478 144 HNVVKSKDIIRDRWVDNPLTLAVQEGATLVYNEFSRTKPVANNVLLSVFEEGVLELPGKRGKSRYVDVHPEFRTILTSNS 223
gi 12230149 142 HNVVKRKDIVRDRWVDNPLTLAVQEGATLVYNEFSRTKPVANNVLLSVFEEGVLELPGKRGASRYVDVHPAFRTILTSNS 221
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3089529  175 AEYAGVYDTQDALLDRLITMFIDYKDIDRETAILTEKTDV-EEDEARTIVTLVANVRnRSGDENSSGlsLRASLMIATLA 253
gi 1708088  180 EEYAGVHSTQDALMDRLVTISMPEPDEITQTEILIQKTNI-DRESANFIVRLVKSFRlATGAEKTSG--LRSCLMIAKVC 256
gi 22095751 205 QEYAGVHASQDALADRLATIDVDYPDRAMELAVASARTGM-AEASAARIIDLVRAFR-ASGDYQQTPt-MRASLMIARVA 281
gi 12644478 224 VEYAGVHEPQDALLDRLIGIYMDFYDLDTEIEIVRAHVDKsADTNVEDIVRVLRELR--ERLDITVG--TRAAIMANEGA 299
gi 12230149 222 VEYAGVHEPQDALLDRLVGLHMDFYDAETETAIVRAHVEA-ADVPVAAIVGMMRELR--ERLEITVG--TRAAIMAAEGL 296
                       250       260
                ....*....|....*....|....*.
gi 3089529  254 TQQDIPIDGSDEDFQTLCIDILHHPL 279
gi 1708088  257 ADNNIPVTTESLDFPDIAIDILFNRS 282
gi 22095751 282 ALEGLDVSVDDPRFVQLCSDALESRI 307
gi 12644478 300 TTVD---TVDQAVLTDICTDVLASKV 322
gi 12230149 297 TAAD---DPDADTVVDVCTDVLASKV 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap