Conserved Protein Domain Family
DNA

?
TIGR02647: DNA 
TIGR02647 family protein
Members of this family are found, so far, only in the Gammaproteobacteria. The function is unknown. The location on the chromosome usually is not far from housekeeping genes rather than in what is clearly, say, a prophage region. Some members have been annotated in public databases as DNA-binding protein inhibitor Id-2-related protein, putative transcriptional regulator, or hypothetical DNA binding protein. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131695
View PSSM: TIGR02647
Aligned: 4 rows
Threshold Bit Score: 111.116
Threshold Setting Gi: 28850697
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 28850697   1 MSYTPELVAELEILALFNLGNTQEGLKVHHVAAPAAVSAAKRLFEKGLTTQVDGGYLTSLGLESAQHAQSLLTILSV 77
gi 24981535   1 MPFTPDLIDEMEVLALFKHDSSQEGIKITSTASPALIAAAQRLHEKGLTDQPDGGYLTSLGHDAVESVQLLQNILKA 77
gi 28806144   1 MKYSAEHIAELNLLLQFDLSSAATGIKVHSDASEEMQAAVARLYQKQLCTQPDGGYLTDEGIEVAEHADKILRVLSA 77
gi 489187009  1 MAFTPELIDELELLALFNLNNTQEGLKVHHTADGKAVAAARRLHDKGLIDQPDGGYLTSLGLDAAEQAQGLLTILKG 77
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap