1ECR


Conserved Protein Domain Family
rep_term_tus

?
TIGR02648: rep_term_tus 
Click on image for an interactive view with Cn3D
DNA replication terminus site-binding protein
Members of this protein family are found on the main chromosomes of a number of the Gammaproteobacteria; this model excludes related plasmid proteins, which score between trusted and noise cutoffs. This protein, DNA replication terminus site-binding protein, binds specific DNA sites near the replication terminus to arrest the DNA replication fork. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131696
View PSSM: TIGR02648
Aligned: 5 rows
Threshold Bit Score: 524.391
Threshold Setting Gi: 2554909
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ECR_A       10 LNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSK 89
gi 36785688  10 LNSCFQQQESKLKQLYEQLNSYSLLAAHVFILPDVEKGCEHEPVTEIIVNEMTGNDARNIGLSHYQKLFIYHNNQNISSK 89
gi 49611715  10 MNDCFQTLEIKLAVMQQQFSTYRLLAGRVYSLPPVEKGTEHDPIEHIAVTQYVGQEARDKGLAHFQRLFIHHYPEALSSK 89
gi 136484    10 LNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSK 89
gi 45436721  23 MNTRFAELEVTLHQLHQQLDDLPLIAARVFSLPEIEKGTEHQPIEQITVNITEGEHAKKLGLQHFQRLFLHHQGQHVSSK 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ECR_A       90 AAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLR 169
gi 36785688  90 AAVRLPGVLCFSVNQQQYRSALLLIEEINKLKAELEHIVTVQSGVDKEQRFEFVHSQLHGLITLNAYRTITPLLNPDSVR 169
gi 49611715  90 SAIRLPGALCFAVNAAQYQQAHTLIAEINALKKELEQIITVESGLEPEQRFEFVHSHLKGLITLSAYRSLTLITNPASVR 169
gi 136484    90 AAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLR 169
gi 45436721 103 AALRLPGVLCFSVTDKELIECQDIIKKTNQLKAELEHIITVESGLPSEQRFEFVHTHLHGLITLNTYRTITPLINPSSVR 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ECR_A      170 FGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQK 249
gi 36785688 170 FGWANKNIINKVTKDQILQRLEKSYNSGRAVSPYSREQWAALVAKEIIDIKKLPDDVVLKIKRPVKVQPIARVWYAEQQK 249
gi 49611715 170 FGWANKHVINNMTRIALLEKLTKSLNAAKHAASYTKAQWIEHVEQEMDAVLQLPEDAVLKIKRPVKVQPIARVWYAEQQK 249
gi 136484   170 FGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQK 249
gi 45436721 183 FGWANKHIIKNVTREDILLQLEKSLNAGRAVPPFTREQWRELISLEINDVQRLPEKTRLKIKRPVKVQPIARVWYQEQQK 262
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|
1ECR_A      250 QVQHACPTPLIALINRdNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD 309
gi 36785688 250 QVQYACPLPIIAFYVN-YGDNQPKIGRLANYDANAIVHRYKPKAKPLELIIPRLHLYREI 308
gi 49611715 250 QVQHPCPSPLLVLCQQeSGGTMPIIGELNPYDAHNIKHKHKPKAAELRLLIPRLHLYTDA 309
gi 136484   250 QVQHACPTPLIALINRdNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD 309
gi 45436721 263 QVQHPCPMPLIAFCQHqLGAELPKLGELTDYDVKHIKHKYKPDAKPLRLLVPRLHLYVEL 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap