2CBN


Conserved Protein Domain Family
true_RNase_BN

?
TIGR02649: true_RNase_BN 
Click on image for an interactive view with Cn3D
ribonuclease BN
Members of this protein family are ribonuclease BN of Escherichia coli K-12 and closely related proteins believed to be equivalent in function. Note that E. coli appears to lack RNase Z per se, and this protein of E. coli appears orthologous to (but not functionally equivalent to) RNase Z of Bacillus subtilis and various other species. Meanwhile, the yihY gene product of E. coli previously was incorrectly identified as RNase BN. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 131697
View PSSM: TIGR02649
Aligned: 3 rows
Threshold Bit Score: 627.814
Threshold Setting Gi: 41017525
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CBN_A         4 LIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSRSM 83
gi 446740140   9 LIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSRSM 88
gi 41017525    3 LIFLGTSAGVPTRSRNVTAILLHLQHPTQPGVWLFDCGEGTQHQMLNTAFHPGKLERIFISHLHGDHLFGLPGLLCSRSM 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CBN_A        84 SGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLECYGYRIEEHDAPGALNAQ 163
gi 446740140  89 SGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLECYGYRIEEHDKPGALNAQ 168
gi 41017525   83 AGNPHPLTVYGPQGVREFIATTLRLSGSWTDFPLQIEEISAGDILDDGLRKVTAFRLEHPLECYGYRVVEHDKPGALNAR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CBN_A       164 ALKAAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAALDLAKGVDVMVHEATLDITMEAK 243
gi 446740140 169 ALKAAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAALDLAKGVDVMVHEATLDITMEAK 248
gi 41017525  163 ALKAAGVTPGPLFQALKAGKTVTLADGRQINGADYLAPAVAGKSVAIFGDTAPCEAALALAQGVDVMVHETTLDASMEEK 242
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
2CBN_A       244 ANSRGHSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATELANDFTVFNV 306
gi 446740140 249 ANSRGHSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATELANDFTVFNV 311
gi 41017525  243 ANARGHSSTRQTATLAREAAVGRLIMTHISSRYDDKGCQRLLAECRAIFPATELAYDFSVFPV 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap