Conserved Protein Domain Family
TIGR02652

?
TIGR02652: TIGR02652 
TIGR02652 family protein
Members of this family of conserved hypothetical proteins are found, so far, only in the Cyanobacteria. Members are about 170 amino acids long and share a motif CxxCx(14)CxxH near the amino end. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131700
View PSSM: TIGR02652
Aligned: 4 rows
Threshold Bit Score: 287.5
Threshold Setting Gi: 86605172
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22296095    6 SHY-PIFGPEIRCPHCRQIIPALTLTDTYLCPRHGPFEADAKTGELMHLQSGRIWRLWEGEWYRQHTHPDGIRFEIHDAL 84
gi 35213127    5 VNYnPIFGPEIRCPHCRQWVAALTLTDTYLCQRHGAFEADPETETLVHLQSGRRWRLWEDNWYRQHTHPDGIRFEIHEEL 84
gi 56687103    6 AQY-PLFGAEISCPHCRQNIPALTLTDAYLCNRHGAFEANPETGELVHLQSGRTWRRWEDQWHRQHTHPDGLRFEIHEAL 84
gi 499748627   5 FSY-PIFGPSIQCPHCRQTIAALTLTDTYLCHRHGAFEADPEQEELVHLQSGRRWRLWEGRWYRQHTHADGIRFEIHEEL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22296095   85 DRLYTQGYRATKVIIAERYRDLFCAYLERSTpwRGATDGQMLRLFGLPVEFS-----PPASQEERWDVINFDLEKEPGAP 159
gi 35213127   85 DRLHTQGYRATRVVVAERYRELISTFLERTT--FGRSEDARHRLYGLPVEFS-----GAADQDGRWSVINFELVKEPGPP 157
gi 56687103   85 DRLFSQGQHAVRVTIADRYRELLRSYWQRSGg-LGAAACSEHRIYGLPVQFS-----PSPKEDPCGAVINFQLESKDGAL 158
gi 499748627  84 DRLRMQGMRATQVIVAERYRSLLTPYLEQGS--QRRP--GPPRLYGLPVSFSsqlpeGAGGSPQRWRVINFELICELDPA 159
                        170
                 ....*....|..
gi 22296095  160 IRPP--YFRMFD 169
gi 35213127  158 LKYP--YFRLFD 167
gi 56687103  159 LRYP--HFRLFE 168
gi 499748627 160 MRQPqsRLQFCD 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap