2MTA


Conserved Protein Domain Family
amicyanin

?
TIGR02657: amicyanin 
Click on image for an interactive view with Cn3D
amicyanin
Members of this family are amicyanin, a type I blue copper protein that accepts electrons from the tryptophan tryptophylquinone (TTQ) cofactor of the methylamine dehydrogenase light chain and then transfers them to the heme group of cytochrome c-551i. Amicyanin, methylamine dehydrogenase, and cytochrome c-551i are periplasmic and form a complex. This system has been studied primarily in Paracoccus denitrificans and Methylobacterium extorquens. Related type I blue copper proteins include plastocyanin, pseudoazurin, halocyanin, etc. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131705
View PSSM: TIGR02657
Aligned: 3 rows
Threshold Bit Score: 114.51
Threshold Setting Gi: 494814
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2MTA_A     23 VDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKV 102
gi 461505  37 VKIAKMKFQTPEVRIKAGSAVTWTNTEALPHNVHFKSGPGVEKDVEGPMLRSNQTYSVKFNAPGTYDYICTPHPFMKGKV 116
gi 113693  49 VDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKV 128

              ...
2MTA_A    103 VVE 105
gi 461505 117 VVE 119
gi 113693 129 VVE 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap