2MTA


Conserved Protein Domain Family
TTQ_MADH_Hv

?
TIGR02658: TTQ_MADH_Hv 
Click on image for an interactive view with Cn3D
methylamine dehydrogenase (amicyanin) heavy chain
This family consists of the heavy chain of methylamine dehydrogenase light chain, a periplasmic enzyme. The enzyme contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from two Trp residues in the light subunity. The enzyme forms a complex with the type I blue copper protein amicyanin and a cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131706
View PSSM: TIGR02658
Aligned: 5 rows
Threshold Bit Score: 671.571
Threshold Setting Gi: 2499788
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2MTA_H        20 EPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVE 99
gi 259016219  58 DPVVLKAAPINARRVFVYDPKHFAAISQFYMIDGDTARVVGTADGGFLSNPVVASDGSFFGQASTVYERIARGKRTDYVE 137
gi 2499788    54 ETSIAIAPASDSKRVYVLDPGNFHMTSTVYTIDGKSSKLLGMTDAGKLPNVMVASDGKFLAIANTMYSRVARGKRDDYLE 133
gi 13432165   49 NITMEPGLPSDAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVMLSSDGKFFVTSNTTYSRIARGKRDDYVE 128
gi 231991     64 EPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVE 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2MTA_H       100 VFDPVTLLPTADIELPDApRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTF 179
gi 259016219 138 LLDPQTNNPIADIELPNSpRFLVGTYPWMTALTPNNKTLLFYQFSPQPAVGVVDLAGKKFDRMIEVPDCYHIFPSSNDTF 217
gi 2499788   134 LIDTKTHQPIADIDIPEG-RFLTGVFERTAGLSVDDKHLLFQQFSPSPGVGLVDLQQKAFVKIMNVPDCYHIFPTANQNF 212
gi 13432165  129 VIDAQSHKVLADIDIPEG-RFLTGVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIFPVPNQSF 207
gi 231991    144 VFDPVTLLPTADIELPDApRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTF 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2MTA_H       180 FMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEA 258
gi 259016219 218 FMHCRDGSLLKVGIGADGKSQ-TKRTEIFHKENEYLINHPAYSPKSGRLVWPTYTGKIFQIDLSSQDAKFLPAIEAFTDA 296
gi 2499788   213 FMHCRDGSLMQFTYDSKGNTK-QKPTKIFHAEKEYLLNNPYYSNSNNHLTWPTYEGKIFQAKLSESGAEFLKPIEVFTDK 291
gi 13432165  208 YMHCRDGSLQQFGYDDKGNLKpMKPTKVFHGEDDYLFVNPYYSNGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEA 287
gi 231991    224 FMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEA 302
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2MTA_H       259 ERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALST 338
gi 259016219 297 EKKEGWAPGGWQQVAYHRESDRIFLLGDQRAASKHKAPSRFLFVIDAKTGKRINKIELKHEIDSVGVSQDAKPQLYALST 376
gi 2499788   292 EKADKWRPGGWQTIAFHKARNELYLLADQREKWTHKLPSRFVFVVDATSGKRLRRIELKHEINSIAVSQDDKPYLYAVSE 371
gi 13432165  288 EKKANWRPGGWQVVAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEIDGISVTQDANPNLYAVSA 367
gi 231991    303 ERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRLLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALST 382
                        330       340       350
                 ....*....|....*....|....*....|...
2MTA_H       339 GDKTLYIHDAESGEELRSVNQLGHGPQVITTAD 371
gi 259016219 377 GDKALYIFDPETGKEVSSVNQLGAGPQVVMTSD 409
gi 2499788   372 EAKTLFTFDAVNGKALSSIDELGRAPSMIFIAD 404
gi 13432165  368 EAKTLFTFNAVTGKETGKVDELGRAPTISLTMD 400
gi 231991    383 GDKTLYIHDAESGEELRSVNQLGHGPQVITTAD 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap