3C75


Conserved Protein Domain Family
TTQ_MADH_Lt

?
TIGR02659: TTQ_MADH_Lt 
Click on image for an interactive view with Cn3D
methylamine dehydrogenase (amicyanin) light chain
This family consists of the light chain of methylamine dehydrogenase light chain, a periplasmic enzyme. This subunit contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from Trp-114 and Trp-165 of the precursor, numbered according to the sequence from Paracoccus denitrificans. The enzyme forms a complex with the type I blue copper protein amicyanin and cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131707
View PSSM: TIGR02659
Aligned: 4 rows
Threshold Bit Score: 333.824
Threshold Setting Gi: 2499783
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C75_L       1 MLGNFRFDDMVEKLSRRVAGRTSRRGAIGRLGTVLAGAALVPLLPVDRRGRVS-RANAAgpA--EGVDPRAKWQPQDNDI 77
gi 2499783   1 MKKDTGFDSKIEKLARTTASKTGRRGFIGRLGGFLVGSALLPLLPVDRRSRLGgEVQAA--T--TGNLTRSGFKPQDKDP 76
gi 2507233   1 MLGKSQFDDLFEKMSRKVAGHTSRRGFIGRVGTAVAGVALVPLLPVDRRGRVS-RANAA--E--SAGDPRGKWKPQDNDV 75
gi 231992    1 MLGNFRFDDMVEKLSRRVAGQTSRRSVIGKLGTAMLGIGLVPLLPVDRRGRVS-RANAA--DapAGTDPRAKWVPQDNDI 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C75_L      78 QACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASXVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRP 157
gi 2499783  77 KACEYWRHCTIDGNLCDCCGGTLTSCPPGSSLSPSSWVASCYNPGDQQTYLIAYRDCCGKQTCGRCNCVNTQGELPVYRP 156
gi 2507233  76 QSCDYWRHCSIDGNICDCSGGSLTSCPPGTKLASSSWVASCYNPTDKQSYLISYRDCCGANVSGRCACLNTEGELPVYRP 155
gi 231992   78 QACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRP 157
                      170       180       190
               ....*....|....*....|....*....|.
3C75_L     158 EFANDIIWCFGAEDDAMTYHCTISPIVGKAS 188
gi 2499783 157 EFNNDIVWCFGADNDAMTYHCTISPIVGKAS 187
gi 2507233 156 EFGNDIIWCFGAEDDAMTYHCTISPIVGKAS 186
gi 231992  158 EFANDIIWCFGAEDDAMTYHCTISPIVGKAS 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap