Conserved Protein Domain Family
nifX

?
TIGR02663: nifX 
nitrogen fixation protein NifX
Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131711
View PSSM: TIGR02663
Aligned: 9 rows
Threshold Bit Score: 177.154
Threshold Setting Gi: 34483456
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984843    1 MKVAFTSTTGEMIDEHFGMAKQFQIWDITPEGASFVETIAIG--AHGDDEE-----DKIAARANALKECAIVYTMAIGGP 73
gi 34483456   18 IKVAFASKDSEFVNEHFGWARQFFIYEVSERGFRLAEIIKHD--EEDEDEE-----GKIDRRIEGIKEAGILYCQAIGPT 90
gi 27350000    1 MKVAFATQDLRRVDAHFGWAKNIAIYDVAPSGHVFLKAIEFEgdLEEDGSG-----DKLAPKIQAIKDCAILYVAAIGGA 75
gi 39651532    1 MKVAFATQDLARVDAHFGWARNIAIYEITADDYRFIEAVQFAeeKE-DGNE-----DKLVAKIDAIRDCAIMYCTAIGGS 74
gi 14025680   26 LRVAIATQDMTNLNAHFGSAKRFAVYDVTREEWHLVEAVAFDdvSDESGKRrtegdDRVTPKVEALKGCHLLFCLAIGGP 105
gi 56544298   27 LRIAIATNDMKSLNAHFGGANRFSIWDVTSDDAHFVEALGFQktSDQSGSHie-geDSITPKVEALADCKLLFILAIGGP 105
gi 128330     20 LRVAIASNDLENLDAHFGSARQIAVYEVWKTGARFVEVHQFSsaTDQKGRHde-leDRIGPKLEALSGCTLVFALAVGGP 98
gi 499270043  26 LRIAIATEDMKGLNAHFGSAKRFAIYDVTAHKSQFMEAIEFDdaSDESGRHrtegdGRIRSRVSALKGCQLLFCLAIGGP 105
gi 499304833   1 MKIAFTTSDRIHINSHFGSAKEIDVYEINAEGYQFLETLNFEgeLKEDGNE-----DKVAPKLAALADCAIVYVVAIGGT 75
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 39984843   74 AAAKLVALKIHPMKT-NTPVSLQETVGRLRDVLKGNPPPWLRKAM 117
gi 34483456   91 AAAKVVRAKIHPIKV-NEEKSIKEALEELTKMLAGNPPPWIKKIL 134
gi 27350000   76 AAARVVASKIHPIKV-SKPESIHVLLEKLESVLKGTPPPWLRKVL 119
gi 39651532   75 GAARVVAAQVHPLKL-AQPELITDLITKLQGVLRGVPPPWLRKAL 118
gi 14025680  106 SAAKVISAKIHPIKV-PQPQTIQEVLLRTQMMLRTCPPPWLRKVL 149
gi 56544298  106 AAAKVVNAGIHPVKL-PAEESIASIIKRVQEMMKGNPPPWLRKAM 149
gi 128330     99 SAARMVRAGMHPIKR-KEPEPISAVIEQVQVMLNGTPPPFLRKVL 142
gi 499270043 106 SAAKVISAKIHPIKA-QQAVSMSQVLSSVETMLQTAPPPWLRKML 149
gi 499304833  76 AAAKLIKKGVTPVKArSEEESISELLNKLVQTLKGNPPPWLRKAL 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap