Conserved Protein Domain Family
nitr_red_assoc

?
TIGR02664: nitr_red_assoc 
conserved hypothetical protein
Most members of this protein family are found in the Cyanobacteria, and these mostly near nitrate reductase genes and molybdopterin biosynthesis genes. We note that molybdopterin guanine dinucleotide is a cofactor for nitrate reductase. This protein is sometimes annotated as nitrate reductase-associated protein. Its function is unknown.
Statistics
?
PSSM-Id: 131712
View PSSM: TIGR02664
Aligned: 5 rows
Threshold Bit Score: 181.589
Threshold Setting Gi: 35211150
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52428432    9 LFNFEIESSEDLTYIPMIVRFNLDRFGLRISLEQWQMLPLEDRRLLARFPADEDVVIEPnFDHALFEMLRTHANVEPSWF 88
gi 22295080    4 FFEFEAEFTASLRCIPMIVRYKLDLCGVKLKLLHWHQLSQQQRQWLVVAPCNTPEDQAT-YRQQLRDWVTHNHGTPPSDL 82
gi 33639596   11 CFAFEQDFIGTWRCIPLCVRRKLDLAGVKLKLSHWLALTQNQRQELVDWS-DAANALDQ-LRQYLRDLTEGMADGVVKDL 88
gi 35211150    6 LLFFEQDFWPELDCIPMGVRYKLDLCATKVSLRHWQLLATAEREELIALACENGEQVDR-YRERLGALAR-QHDFPLVPI 83
gi 499304015   4 FFEFESDFVDSLRCIPMQVRYKLDTCGIKLKLADWNQMTQAEREALVELPCTTAAEIQS-YQEYIQHLIINRTGTPPGNL 82
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 52428432   89 QPDEHPAWRSVDAVPDALVAQSGLAGLPAPSASQWATLTPFQRYVLTKLSRKPKLNHDFVPAMREF 154
gi 22295080   83 EIPQTFPWDILTELPETVQQQLTKVPHHSLTVEKWATLTPLQRFALVKLSQPGHENRNFWPALQEF 148
gi 33639596   89 PPAVGAAWQQQSVLPAEIHRAAVARG-VELTPEQWAHVTELERFALCKLVRPGHDHHNLDAAFSEV 153
gi 35211150   84 DPDP-APWQ-------------AEVPRLAMEAPLWRAMNPFERFVCLKAQASSKQAELLPRVLALL 135
gi 499304015  83 PIDSKPAWLDSSSIPDSIEDKAQEIG-VTLTLSQWVNLTPLQRFALIKLSRSGHENKNFPKAIAEF 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap