1R2K


Conserved Protein Domain Family
moaB_proteo

?
TIGR02667: moaB_proteo 
Click on image for an interactive view with Cn3D
molybdenum cofactor biosynthesis protein B, proteobacterial
This model represents the MoaB protein molybdopterin biosynthesis regions in Proteobacteria. This crystallized but incompletely characterized protein is thought to be involved in, though not required for, early steps in molybdopterin biosynthesis. It may bind a molybdopterin precursor. A distinctive conserved motif PCN near the C-terminus helps distinguish this clade from other homologs, including sets of proteins designated MogA. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin]
Statistics
?
PSSM-Id: 131715
View PSSM: TIGR02667
Aligned: 11 rows
Threshold Bit Score: 270.446
Threshold Setting Gi: 13421103
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1R2K_B         6 EFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQ 85
gi 21107080    6 DFIPLRLCVLTVSDSRTLADDRSGDYLADVLTHEGHVLHERALCPDDRYRMRAIVSGWIADAQVDGILITGGTGFTGRDS 85
gi 266541      7 EFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQ 86
gi 13421103   16 PFTPVRVAVLTITDTRDEASDTSGQILVERIKAAGHELGGRVVVRDDIEQIRAQVRSWIDSKTVDAIVTTGGTGLTGRDV 95
gi 33567912    5 KQVSLACAILTVSDSRSAGDDTSGNMLAESLAHAGHMCVRRDLVKKDLYQIRRVISEWIADPAVQVILVSGGTGFTPRDC 84
gi 499356666   8 TFVPLNIAVLTVSDTRSEENDTSGQALVERLTQAGHNLADKAIVIDDVYQLRAQVSKWIADDSIHAIISTGGTGFTARDN 87
gi 499654539   8 PFVPLNIAVLTVSDTRTLETDTSGQVFVDRLTAAGHHLAQRVLLKDDLYKIRAQVAHWIAEDVVQVVLITGGTGFTGRDS 87
gi 496670913   8 TFQPLNIAILTVSDTRTLETDTSGQTLADALLAAGHRLHQRSLKTDDIYQIRAVVSAWIADPEVQVGLITGGTGFTARDN 87
gi 53757336    5 EFLPLSIAILTVSDTRTEDDDSSGRVLVGRLTEAGHRLAEKCIVPDDIYRIRAVVSRWIADPDIQVVISTGGTGVTGRDG 84
gi 501531190  12 AFLPLAIAILTVSDSRKPETDKSGDKVAELASHAGHQIAARQIIADDAETLRAQMRDWIADPAIDVIIATGGTGVTGRDV 91
gi 499273630  16 PFIPLGIAVLTVSDSRTLENDKSGDTLVARLEEAGHRLAARAIVPDDKAAIAETVREWTLSEGVDVVITTGGTGFTGRDV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1R2K_B        86 APEALLPLFDREVEGFGEVFRXLSFEEIGTSTLQSRAVAGVANKTLIFAXPGSTKACRTAWENIIAPQLDARTRPCNFHP 165
gi 21107080   86 TPEAITPLLDKVMPGFGEMFRAISVEEIGTSSLQSRAFAGLANHSFVFCLPGSTSACRTAWEKIVRAQLDARTKPCNLAT 165
gi 266541     87 APEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHP 166
gi 13421103   96 TVEALEPLFDKKIDGFSVVFHLVSYASVGLSTLQSRATAGLIESVFVFCLPGSNGAVKDGWDKVIAAQLDSRHKPCNMVE 175
gi 33567912   85 TAQAIEPLFDKTIEGFGELFRQLSYEEIGSSAVQSSALAGTANDTVIFCMPGSNHACKLGWNRIIREQLDDAHKPCNFAM 164
gi 499356666  88 TPEALTPLFDKAVEGFGEVFRHVSLLEIGTSTIQSRAFGGIANKTVVLCVPGSTNACKTAWDKVIKEQLDASHRPCNFVP 167
gi 499654539  88 TPEAVACLLDKQVDGFGELFRQISVPDIGTSSVQSRALAGLANGTLVCCLPGSTNAVRTGWDGILAEQLDSRHRPCNFVT 167
gi 496670913  88 TPQAVGPLFERDVEGFGELFRQVSQREIGTSTIQSRALAGLSNGTLVCCLPGSPGACRTAWNEILLAQLDSRTRPCNFVP 167
gi 53757336   85 TPEAVSVLFDKTLDGFGEVFRAISYQEIGTSTIQSRAIAGVANGTYVFALPGSSGACRTAWDKLIRQQLDLRTRPCNLAE 164
gi 501531190  92 TPEALAPLISKPIPGFGELFRMLSFQEIGTSTIQSRAEAAICDGTIVFLLPGSTGGVRLGMEAIIIPQLDIRHAPCNLSE 171
gi 499273630  96 TPEALEPLFEKRMDGFSALFHRISYDKIGTATIQSRATGGVANATFIFVLPGSPGACKDAWDGILKAQLDYRHLPCNFVE 175

                 ...
1R2K_B       166 HLK 168
gi 21107080  166 LRP 168
gi 266541    167 HLK 169
gi 13421103  176 LMP 178
gi 33567912  165 HYR 167
gi 499356666 168 HLN 170
gi 499654539 168 HLK 170
gi 496670913 168 HLK 170
gi 53757336  165 LIP 167
gi 501531190 172 LLP 174
gi 499273630 176 IMP 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap