Conserved Protein Domain Family
cas_csx9

?
TIGR02671: cas_csx9 
CRISPR-associated protein Cas8a2/Csx9, subtype I-A/APERN
Members of this family, so far, are archaeal proteins found in CRISPR-associated (cas) gene regions. So far, this rare cas protein is found in only three genomes: Pyrococcus horikoshii shinkaj OT3, Pyrococcus abyssi GE5, and Thermococcus kodakarensis KOD1. In each case it is found immediately upstream of cas3 in loci that resemble the Apern type but lack Csa1 and Csa4 genes.
Statistics
?
PSSM-Id: 131719
View PSSM: TIGR02671
Aligned: 3 rows
Threshold Bit Score: 705.918
Threshold Setting Gi: 14521228
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57158710   23 MSWVVMDAGIEPDEEELADTLEGALKSLGSRVKIHTSKMGRNDRSSFDKVLKAWFGRSAPETYGELFELVVTETIKLLRD 102
gi 499187469   1 MSWVVMEAGLEPDKEELIEALEGALNSLESRTRINTSKIGRNDRNSFNDVLQAWFNRSTPETYGELFELVIRETIKLLKE 80
gi 499169865  23 FSWIVMDAGLSPNPNDFADAIENSMDTLKKRAMMNSSRIGKNDRNSYDRVFSKWFGVKAPDTYMELFELVINETIKLLRS 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57158710  103 GNIDPGESLSTIKTDKNGTYLGIAYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFMALGFFTSFAGF 182
gi 499187469  81 DKIDPSASLSTIKTDKNGTYLGVVYKEKQAILPAILKQPEYYEYQSSFLKPTTARKAQIRMDPLWFSFMALGFFTSFAGF 160
gi 499169865 103 GKIDPAKSLQSITRNKNGTYLGQAYNGEYAITPAVIKQPEYYEFQSEFLKPTAGQKAQIYLDPLWFSLLSMGFLTAFAGY 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57158710  183 IGGKYYLMTKPGIEVFWPYEVEEIIEKGILPLTGAGASGRISLSTEELYEMKLAMKLAEEGRDVIEEVYPVTLHLISLEG 262
gi 499187469 161 ISGKYYLITKPGIEGFWPYEVEDIIEHGILPLTSAGASGRISLTTEELYEMKLAMKLAEEEKNIIDEVYPVTLHVISLEG 240
gi 499169865 183 IRKRYYLMTKPGIEVYFP-DVEEILIDGIIALTDAGISSRARLDAEELYELRIVMKLAEEGRKVPEMTYPIALH-ISLEG 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57158710  263 QVYTELKTTQLNLTGLSEYMEEYVNRIESASMGGLPILVELKAGNATIQKYPLWALVDIAERELWKGVNGDGEMLAYIFV 342
gi 499187469 241 QSYTELKTIQLNLIELNNYITEYVKKIRASKVGSMSLLVELKEGGATVKKYPLWALVDIAEKEVWKGVKGDEEMLAYIFV 320
gi 499169865 261 QVYTELKTLQLDLKELSNYLATYVKKIENYRVMGVDLKVKLKEG----EKYPLWALVDIAEKELNKGVSGDRELLAYIFV 336
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 57158710  343 KDLYRAINSGRRELIRDAVFRLFRQGRALLEGSGRASGEFRKVMKTFMWQEHLEVLL 399
gi 499187469 321 KDLYRAINSGKKDIIQDSIFRLFRQGRALLEGSSRGSGEFRKVMRTFMWEEHLGVLL 377
gi 499169865 337 KDLYRAVNSGRKELIEDSIFRLFRQGRGLLEGEGRASGELRKVLRVFMQEDHLEVLI 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap