Conserved Protein Domain Family
cas_csm6

?
TIGR02672: cas_csm6 
CRISPR type III-A/MTUBE-associated protein Csm6
Members of this family as found in CRISPR-associated (cas) gene regions in Streptococcus thermophilus CNRZ1066, Staphylococcus epidermidis RP62A, and Mycobacterium tuberculosis (strains CDC1551 and H37Rv), as part of Mtube-type CRISPR/Cas systems. CRISPR is a widespread form of direct repeat found in archaea and bacteria, with distinctive subtypes each of which has a characteristic sporadic distribution.
Statistics
?
PSSM-Id: 131720
View PSSM: TIGR02672
Aligned: 3 rows
Threshold Bit Score: 479.034
Threshold Setting Gi: 55738904
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57636537  61 IQTVSPNTEVEIIIEN-VDNAQDYDVFKEKFHKYLKIIEDSY-EDCEIILNVTSGTPQMESTLCLEYIVYPENKKCVQVS 138
gi 55738904   1 MFSIAPNYEPELIIHDpIISDNEVHIFDVMFQRFSDILQEYYtKEDEFILNLSSATPQIKSALFVINRLNGINIKAVKVW 80
gi 13882657  70 ITRLAPETDVRIVTYT-NPSVHRFDLFVPVFRNHLVELSAEF-PDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVS 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57636537 139 TPTKDSNA--GIEYSNPKDKVEEFEIVNEVEKKSEKRCKEINILSFREAMIRSQILGLIDNYDYEGALNLVSNQKSFRNG 216
gi 55738904  81 SPEHASNE--NIGHDNDENIDELIKVNEDNKVNFIDRTIEDNAEKFSQALLKKTARDFIEKFDYKAALDILDQLSDFPNL 158
gi 13882657 148 TPARALSKpgDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQV 227
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57636537 217 K-------------------LLRKKLLSLTKQIKTHEVFPEINEKYRDDALKKSLFHYLLLNMRYNRLDVAETLIRVKSI 277
gi 55738904 159 KslreeirdvvnclskkkiaYIREKLYDFSRVFKNQSILSDILSFPLDDSQKKALNYYLMIDVLKEREHIADVLIKAKSL 238
gi 13882657 228 Sn------------------LIRGAMHRSRLEHLVAPKFFKDTAFTYDPAN-KVAEYISALALLAKREQWAEFARSATPA 288
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57636537 278 AEFILKTYIEIHWPTLIIEKDGKPYLND---------EDNLSFVYKYNLLLEKRKQNFDVSRILGLPAFIDILTILEPNS 348
gi 55738904 239 AEFVIEEIIKKDHEGLIVFDGNLPKLNPsfpdceailDDIDKKMKKSRGIEDTEERIFSVQSTLNLLSYLNILEFYEYDS 318
gi 13882657 289 ITIVLRAAVAKHLPEDRYLDD-MGRVDR----------RKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDR 357
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 57636537 349 QLLKEVNAVNDINGLRNSIAHNLDtlNLDKNKNYKKIMLSVEAIKNMLHISFPEIEEEDYNYFEEKNKEFKEL 421
gi 55738904 319 QLQTAINGILSLNGERNKVAHGLS--EIDTRLLSRKKLKQLSENLRLLLVDCLGIDSSYFNYYDKQNKELTKM 389
gi 13882657 358 VGALEVLGRFESR-VRNTAAHEIVsiSEDR---ITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDM 426
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap