Conserved Protein Domain Family
cas_cyan_RAMP_2

?
TIGR02674: cas_cyan_RAMP_2 
CRISPR-associated RAMP protein, Csx10 family
CRISPR is a widespread repeat family in prokaryotes. At least 45 different protein families occur in prokaryotes only when these repeats are present. This family, a minor CRISPR-associated protein family, seems largely restricted to the Cyanobacteria. It belongs to the RAMP superfamily (pfam03787).
Statistics
?
PSSM-Id: 131722
View PSSM: TIGR02674
Aligned: 4 rows
Threshold Bit Score: 532.903
Threshold Setting Gi: 163847828
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499304872   1 MKRIELTIKALSPLAIGKQKPGGSINEAERYIPGSVLRGAIAKHILQRaGRELENLATNGgDFADLFLAENPAIFQNAYP 80
gi 499749034   1 MEAIELTLTAESPLAIGRQKPGGSISEAQDFIPGSVIRGALADLLLRQ-SRHRPGEALTG-DLAALFTEARAAVFTHAYP 78
gi 501215119   1 MNIIPYRVTLLEPLLATRIAGDPNSGVSYPYVPGSLVRGAAVAMYARN-K-GIVAVDAREeEARRLFFDGRTRYLN---- 74
gi 501215138   1 ---MWLKIKPNNPLILGDVRASSQFLSPTQYIPGRILRGAWAEWLLIQ-GRQDILPTVQRvRIGNFFPTTEWRPICYALP 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499304872  81 avakvgskhqvvdnnikVLPATAVSSKANPGFLPKG------H-GVFDTLIDSFCAEQFQHS--YDPsslkALEQGVDPR 151
gi 499749034  79 gsg------------srVLPATAFSSKNNPGFRSEAg----kT-GVFDTLLDRFCSQRLGIP--FDP----AEPDGSGGR 135
gi 501215119  75 -----------------AYPADASGRRTLPTPRSLF------HvEGEESPIYDFALEVIDAV--N------EETVQFVGA 123
gi 501215138  77 ------------------LPLSALTCKQASGFKKEPhpdnqgH-GVVDALIPQLAYSLLERAgaCFAapfvLTCLTCGSR 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499304872 152 VETYNSLYSKHn----EQYCTHAATSRLLTRVGINRYRATSSDDILYSIEVLNEAfivaNEGKNQEWDNYVYRGYINVSN 227
gi 499749034 136 VEPFGGFYSQEe---gSRYRRVAVSKRLLTRVGINRRRATAADQILYSLEVINEG----RAGRDGSLQPSLFSGHIYLQD 208
gi 501215119 124 ARDSQPFCRIDds--nIFFISPKRRINVHTQRDRVKGRATEVSGAVFQYDALEE--------------GQTFAGWVLVDK 187
gi 501215138 138 MEAITGFYTVYrdgttERYCQSRLRYHSQTKVGISRYRRAAVEQVLYTANALSPV----TVQPDEKVSDLVFLGRIYGER 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499304872 228 DELATKLTNFINnnsEVFRLGGSVSRGLGKVEITAKEIPVA-DDISSRIHVFNQALHKRWQDWsEAFGDGLRPAKSD-RT 305
gi 499749034 209 RELAAALAGYLNthaRRLSLGGGVSRGLGRVSLAARHLRAPkPSLAERVAAFNQKLRQRWQQW-QVFGNPWQPLPPE-RQ 286
gi 501215119 188 DDDVELLSSLLR---HIYRLGGSSNSGYGRVTVAVDAPQNI-Q-VWREIPKQIVPIDAGETFVvTLLSDTLVRDPNT-GQ 261
gi 501215138 214 SDVADLIEAIN-----HIAIGALHTRGYGRVKAEEAEVVGF-PDIEERVRLFNEILVHCWQDLkSLATNAEDLPAKPeGT 287
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499304872 306 pnptskrtFFTLNLHSDVILTEDwqrttvISPEMLQQFADVEDPSLKLHTAYSSYSYTSGWNSAWGLMKDVELVTNKGSV 385
gi 499749034 287 --------YFSIGLQSGAILKERwqrttvLTPPMLQEEANCEDGSLVLELACSSYAYVSGWNAAWGLFKDVELVTTQGSV 358
gi 501215119 262 --------Y-TWDLRPALQQLLS------VEIEHIHPIAGEEEQ-----RSVWRLDEVGGFNRAWGLPLPQAQAIAGGSV 321
gi 501215138 288 --------YFSVDLLSPGVFQD-------SGIPALAPILRINGQALEPVWWMTRPDFAGGWSTAWGLPKPTNLAARMGSV 352
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|..
gi 499304872 386 YLFSTE-NRQLWEDALSSLELRGVGDRTCEGFGQVEICNEFHQIFR--ENPV 434
gi 499749034 359 FLLSTT-QMERWIPILAEMEYWGIGERTAEGFGQIEVCSLFHHHFW--ENPL 407
gi 501215119 322 FVFRAR--SPIPAQTIAGAEWDGIGERRAEGFGRLAFNWQTETELIrvDPPV 371
gi 501215138 353 YVYRWDgTLDEIISTLQTLEEQGVGKRRDEGFGEFLVCHPFHQEVE--EK-- 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap