Conserved Protein Domain Family
phage_pRha

?
TIGR02681: phage_pRha 
phage regulatory protein, rha family
Members of this protein family are found in temperate phage and bacterial prophage regions. Members include the product of the rha gene of the lambdoid phage phi-80, a late operon gene. The presence of this gene interferes with infection of bacterial strains that lack integration host factor (IHF), which regulates the rha gene. It is suggested that pRha is a phage regulatory protein. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 131728
View PSSM: TIGR02681
Aligned: 4 rows
Threshold Bit Score: 165.374
Threshold Setting Gi: 49177375
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49177375  18 VSEFVFTERNQVVTDSLTMAQMFGKEHKNVIRDIEVqleKLIEAnetEWGQLNFEPTQYQHYQNKQWyPKFNLTEDAFAI 97
gi 12722192  25 VFPKVFHKETVAMTDSLKVAHYFGKRHDNLLNTIKN---LGCSD---EFRLLNFKESYYLNEQNKKQ-PMFYMTQDGFTL 97
gi 1175786   11 QFLKVNDKQRI-VTNSRHIATVFGKRHDNIIRDIKA---LVIEQdcgEFALLNFEETSYFDEWGRKQ-PMYQMTKNGFLL 85
gi 46450005   5 SIPTVDLVAGRPVVSSLRLAEHFGKKHFNVIRDIRS---VSAEVs-pEFNQLNFECVEYVDEKGETR-PMYNLTRDGFTI 79
                        90       100       110
                ....*....|....*....|....*....|..
gi 49177375  98 VAMSYITPEAMKMKIKFLQEFKRMKEHIQKVQ 129
gi 12722192  98 LVMGFTGKKAMQFKEQYIKEFNEMKKRLATRA 129
gi 1175786   86 LVMGYRTQKAMKFKVEFIKAFDFMREKLQQEG 117
gi 46450005  80 VAMGYTGPKAMRMKEAYIRRFNEMERTLAHGP 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap