2WD7,1MXH,1P33


Conserved Protein Domain Family
pter_reduc_Leis

?
TIGR02685: pter_reduc_Leis 
Click on image for an interactive view with Cn3D
pteridine reductase
Pteridine reductase is an enzyme used by trypanosomatids (including Trypanosoma cruzi and Leishmania major) to obtain reduced pteridines by salvage rather than biosynthetic pathways. Enzymes in T. cruzi described as pteridine reductase 1 (PTR1) and pteridine reductase 2 (PTR2) have different activity profiles. PTR1 is more active with with fully oxidized biopterin and folate than with reduced forms, while PTR2 reduces dihydrobiopterin and dihydrofolate but not oxidized pteridines. T. cruzi PTR1 and PTR2 are more similar to each other in sequence than either is to the pteridine reductase of Leishmania major, and all are included in this family.
Statistics
?
PSSM-Id: 131732
View PSSM: TIGR02685
Aligned: 6 rows
Threshold Bit Score: 471.72
Threshold Setting Gi: 1172740
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WD7_A        3 APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSN-------------V- 68
gi 27465168  11 CPAAIITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSS-------------S- 76
gi 62358992 104 APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSN-------------V- 169
gi 1172740    7 APVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADASTLAATLNARRPNSAITVQADLSNVAtasfsetdgsvpvT- 85
1MXH_A       11 CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSS-------------S- 76
1P33_A        7 APVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADASTLAATLNARRPNSAITVQADLSNVA-------------Ta 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WD7_A       69 ------------LPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHED----NSNGKTVETQVAELIGTNAIAPF 132
gi 27465168  77 ------------LLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPGDDTNg---AAEAKPIDAQVAELFGSNAVAPL 141
gi 62358992 170 ------------LPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHED----NSNGKTVETQVAELIGTNAIAPF 233
gi 1172740   86 ------------LFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKDAGEggssVGDKESLEVAAADLFGSNAIAPY 153
1MXH_A       77 ------------LLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPGDDTNg---AADAKPIDAQVAELFGSNAVAPL 141
1P33_A       74 sfsetdgsvpvtLFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKDAGEggssVGDKESLEVAAADLFGSNAIAPY 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WD7_A      133 LLTMSFAQRQkGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA 212
gi 27465168 142 FLIRAFARRQ-GEGGAWRSRNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPA 220
gi 62358992 234 LLTMSFAQRQkGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA 313
gi 1172740  154 FLIKAFAQRVaDTRAEQRGTSYSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLSVLPDD 233
1MXH_A      142 FLIRAFARRQ-GEGGAWRSRNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPA 220
1P33_A      154 FLIKAFAQRVaDTRAEQRGTSYSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLSVLPDD 233
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*.
2WD7_A      213 MGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA 268
gi 27465168 221 MPQETQEEYRRKVPLGQSEASAAQIADVIAFLVSKDAGYITGTTLKVDGGLILARA 276
gi 62358992 314 MGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA 369
gi 1172740  234 MPFSVQEDYRRKVPLYQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGYSLTRA 289
1MXH_A      221 MPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA 276
1P33_A      234 MPFSVQEDYRRKVPLYQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGYSLTRA 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap