Conserved Protein Domain Family
TIGR02688

?
TIGR02688: TIGR02688 
TIGR02688 family protein
Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131735
View PSSM: TIGR02688
Aligned: 6 rows
Threshold Bit Score: 639.836
Threshold Setting Gi: 18159212
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984093    9 LVDVFSGKVVRKD-LVRKVKVGANVPVFVLEYLLGKYCATDDEaAMEAGLRVVNNTLAENFVRPEEANKAQALVREKGR- 86
gi 20904506   17 LIQHFPGRVVRKD-LTKLLKVGHNVPVYVLEYLLGSYCADDDEeVIQEGIQIVKNILSQNYVRPDEAEKIKSRIRETGY- 94
gi 46449844    8 INTHFPGLVVRKD-LVKTVKGNAIVPSYVLEYLLGQYCATSDEpTIQTGIETVKEILAKHYVHRNEAGLVRSNIKEKGR- 85
gi 18159212    8 VKRCFGDYAVDKR-LAYELEL-AKLPRYVAEFLISEFMTLGG-----DWEGKLRSFIRERYYEPEEKEVVKHKLVTEGV- 79
gi 501538693   9 IRDVFPDESVYKMpQNYGVFSGRNIPSFIKDWLIKKFTDEDGT-L---DKQGLLSYLDRFLPDKKQAQIIKKQLVQTQEp 84
gi 501802296  18 VERVFRGLVIDKRrLPASQLQKRGVPAYVGEWLLDTLVPGRGE-LTEEEARKVREWAEKYVPGPNDQQIIKHRLLQGEV- 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984093   87 HTFIDKVKVRYLAEDDKYWAECVNFGHKYLH--IPERYIREYDRLLMGGVWAQMEIRHQy-dEEAKGrrSPFWIESITPI 163
gi 20904506   95 YTVIDKITVILNERRDIYEAEFSNLGLKNIE--IDSDYVIKYDKLLGGGIWCMIKMEYS---TESAS--SPFIISSLKPI 167
gi 46449844   86 YKVIDKISVDLNDKKDVYQAQFSNLGLKEVL--VDSGTVKKHPKLLVGGVWCIADLEYEf-tEDKSA--SPWILSTLKPI 160
gi 18159212   80 VELIDELRVYVDVETGAHIGVIHAL-DIWAE--VPVDIVERNRATLTTGMWGLITLQRWegvREILGrpVSVVVTDFKPF 156
gi 501538693  85 YTVLARVQTQADIKKGIIRFSIPDFGIGPGEgiIPRSLIEAHPELMADEIWGIFTLVYEp---EDEHtpGHISVMDFKPF 161
gi 501802296  96 IKVLTPVQVEVSLARATRSAKLRLLGIEDAA--ISDELPTRYPDLLRQGMWGVVELLSTg---------DGVAIQSFRPM 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984093  164 QLATFDLNAYQEGRRQFTSEEWVDMLIRSVGMEPEHFT-RRLKLLFLIRLIPLCEANYNLVELGPRGTGKSYAYQELSPY 242
gi 20904506  168 QIPNVNIQEILAERKNFTKDEWIDVLMRSIGMEPTQLE-TSTKWHMLERLVPLVENNYNLCELGPKSTGKSHVYKEISPN 246
gi 46449844  161 QLSHFDFDGYVEARKQFTTDEWIDLLVQSIGFNPEMFG-KRSKLTQLVRLIPFCERNYNLIELGPKGTGKSHIYSEFSPH 239
gi 18159212  157 QAPDTDPKILEEGRGCFTLEEWVEVLINTIGLDPAVYS-PRQRLLLLARLVSLVEGNVNMAEFGPRQTGKTYLYRNVSNY 235
gi 501538693 162 KPYEVDLDYFKEGRKEFTLEEWIDVLIRAMEYMPTGFEsAQQKLLFLSRLLVFVEPRLNMIELAPKGTGKSYIFNNLTKY 241
gi 501802296 165 QAS-LDLGLYKEARQEFTLDEWLRLMLTSMGYAPEAFT-AEEQLWLIARLLPLVQKNLHLVELAPKATGKSYFYENISPR 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984093  243 AILMTG-PTTVANLFFNISTNKMGLVGLWDAVAFDEVAD-LEKMPKEVVTTMKTYCESGSFAR-GKESLSGMASIALFG- 318
gi 20904506  247 TILMSGgQTTVANLFYNMGTRQIGLVGFWDVVAFDEVAG-IRFKDKDGIQILKDYMASGSFAR-GKEQKNANASIVFVG- 323
gi 46449844  240 GILISGgEVTVPKLFVNNSSGKIGLVGYWDCVAFDEFAGkQKRVDKALVDIMKNYMANKSFSR-GVETLGAEASMVFVG- 317
gi 18159212  236 VRIISGgVISPAALFYNLRTKVPGELALKDAVVFDEVSKvRFPNPDEMMGKLKDYMESGHYER-GDKKVVSDASLVFMGn 314
gi 501538693 242 GWCISGgTVTRAKMFYDISRRSFGYITRYDFVALDEIETlKFAEEEELKGALKNYLELGKFTI-ADVTKTSEAGFMLLG- 319
gi 501802296 243 VRLVSGgNITPAVLFVNNATGQWGLLARYAVVVLDEVQTlKFEKPEEIIGGLKGFLANGRLTRgGLHEASSDCSFVMLA- 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39984093  319 -NTNQ--PVETMVKSSHLFIPLPEIVReDMAFLDRIHYYIPGWEIPKMR--IEYFTQHYGFVVDYLAEALRELRR-H-NF 391
gi 20904506  324 -NVNQ--SIESLLKTSHLFSPFPEAMNsDTAFFDRMHYYLPGWEIPKFR--PEHFTDRYGFIVDYIAEFFREMRK-R-SY 396
gi 46449844  318 -NTQH--TVPYMLKHSDLFCELPDKFY-DSAFLDRIHFYIPGWEVDIIR--GEMFSNGYGFVVDYLAEILRSLRN-H-DY 389
gi 18159212  315 vSVEL--TSEGYVPVEDLTYVLPEPMR-DSAFIDRIHGLLPGWELPKISqsKYHLSKGYGVASDYFAEALHGMRK-E-SL 389
gi 501538693 320 -NIPL--TSEHKPINDIYFSHLPDFFR-DSALLDRFHGFIEGWHLPRIN--EDMKVSGYTLNVEFFSEILHKVRE-RsEY 392
gi 501802296 322 -NVPLdeKQEPIIQQNSLVDYLPEFMR-ETAFLDRIKGLLPGWKIRKLS--KEAFANSVGLKADFFGDALLTLREdL-EI 396
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 39984093  392 TEVSDRYFSFGAH-LNARDVKAVRKTVSGLVKLLYPHGE----FTKDEL-AETVDIAMEGRRRVKEQLKKMGS 458
gi 20904506  397 ADNINRFFKLGNN-LNQRDVIAVKKTFSGLMKLIYPDEN----ITREQA-QEILEYTLVGRRRVKEQLKKIGG 463
gi 46449844  390 SDRYKDHFSLSSD-ISTRDRDGINKTFSGLMKILFPHGG----ATKEEV-EELLRFAIEGRKRVKDQLMRIDS 456
gi 18159212  390 SGLVGRHVELSEN-FKIRDEKSFKRITSGLLKLLFPDKT----FDKKEL-KTIAEFALELRQRVRDWLHKIAP 456
gi 501538693 393 AAIVDELLDIPPK-ADTRDVTAVKRLCTAYLKILFPHITdssqITKEEFeTYCLKPALEKRAIVKRQIHLMDP 464
gi 501802296 397 DQYCARRIRLRGNrPYARNEIAVQALASGMMKILFPHGR----VSDWDFrHYCVEPAVQLRQGIWDLLYQLDG 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap