2L17


Conserved Protein Domain Family
ars_reduc_gluta

?
TIGR02689: ars_reduc_gluta 
Click on image for an interactive view with Cn3D
arsenate reductase, glutathione/glutaredoxin type
Members of this protein family represent a novel form of arsenate reductase, using glutathione and glutaredoxin rather than thioredoxin for reducing equivalents as do some homologous arsenate reductases. An example of this type is Synechocystis sp. strain PCC 6803 slr0946, and of latter type (excluded from this model) is Staphylococcus aureus plasmid pI258 ArsC. Both are among the subset of arsenate reductases that belong the the low-molecular-weight protein-tyrosine phosphatase superfamily. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131736
View PSSM: TIGR02689
Aligned: 4 rows
Threshold Bit Score: 252.9
Threshold Setting Gi: 35210564
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2L17_A        5 KKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCG 84
gi 1653494    2 KKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCG 81
gi 35210564   2 KKVMFVCKRNSCRSQMAEGYARTLGAGVIEVVSSGLEASRVHPTAVQVMAAAGVDIAGQISKPLSDFGSEDFDVVISLCG 81
gi 17130451   2 KKVMFVCKHNSRRSQMAEGFTKILGKDNIAVTSAGLAVSQIDPFAIEVMSEIGIDISNQTSKPLENFHPEEYDAVISLCG 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
2L17_A       85 CGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLI 130
gi 1653494   82 CGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLI 127
gi 35210564  82 CGVNLPEAWLTREIFEDWRVEDPDGQPVEVFHRVRDEIKQRVQNLV 127
gi 17130451  82 CGMNLPEAWVLRDIFEDWQLDDPQGESIETFRRVRDEIKERVVKLI 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap