1JL3


Conserved Protein Domain Family
arsC_pI258_fam

?
TIGR02691: arsC_pI258_fam 
Click on image for an interactive view with Cn3D
arsenate reductase (thioredoxin)
This family describes the well-studied thioredoxin-dependent arsenate reductase of Staphylococcus aureaus plasmid pI258 and other mechanistically similar arsenate reductases. The mechanism involves an intramolecular disulfide bond cascade, and aligned members of this family have four absolutely conserved Cys residues. This group of arsenate reductases belongs to the low-molecular weight protein-tyrosine phosphatase family (pfam01451), as does a group of glutathione/glutaredoxin type arsenate reductases (TIGR02689). At least two other, non-homologous groups of arsenate reductases involved in arsenical resistance are also known. This enzyme reduces arsenate to arsenite, which may be more toxic but which is more easily exported. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131738
View PSSM: TIGR02691
Aligned: 9 rows
Threshold Bit Score: 243.921
Threshold Setting Gi: 12724358
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JL3_A        6 IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDA 85
gi 28269853   4 IYFLCTGNACRSQMAEGFAQQLLGPNWQVASAGVETHGLNPLAVQVMSEVGIDISDQVSKLIDLTYLNQCAVVVTLCGDA 83
gi 12724358   4 VYFLCTGNSCRSQIAEGYGHKNLEG-WEVRSAEIETHGLNPRAVKVMAEEGIDISSQKSELIDLDYFNECDLIITLCGDA 82
gi 5802943    7 IYFLCTGNSCRSQMAEAWGKKYLGDKWNVLSAGIEAHGVNPNAIKAMNEVDIDITDQTSVTIDRDILDKADLVVTLCGHA 86
gi 17366928   6 IYFLCTGNSCRSQMAEGWGKKYLGDEWDVYSAGIEAHGVNPNAVKAMKEIGIDISEQTSDTIDQELLQKADLVVTLCGHA 85
gi 1168520    6 IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDA 85
gi 59799155   6 IYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDA 85
gi 20516009   6 LYFICTGNSCRSQMAEGFGKFYGGDDFEVYSGGVEAHGLNSKAVEVMKEIGIDISNQTSDLIDENILFKADYVITLCGDA 85
gi 41582601   4 IYFLCTGNSCRSQMAEGYGKILLKDKYEVKSAGIEKHGLNPYAVKAMAEDGVDISQQKSKLIDPDYLNSADLVVTLCGDA 83
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
1JL3_A       86 ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 134
gi 28269853  84 RDRCPVTPATVTRLHWPLPDPARTTGSVSDQLLVFRQVRDQIKARVIDL 132
gi 12724358  83 LDKCPMIPKGVNHEHWDLQDPACAIGSETEILAEFRKTRDLIKEKVKMI 131
gi 5802943   87 NDVCPTTPPHVKRVHWGFDDPAGQE------WSVFQKVRDEIGERIKKF 129
gi 17366928  86 ADVCPATPSNKERVHWGFDDPAKAEGTDEEKWAVFRRVRDEIGKRIKTF 134
gi 1168520   86 ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 134
gi 59799155  86 DNNCPILPPNVKKEHWGFDDPAGKE------WSEFQRVRDEIKLAIEKF 128
gi 20516009  86 RDKCPALPPSVKSLHWELEDPARAEGTEEEIMNKFREVRDIIKEKVKAL 134
gi 41582601  84 RDRCPALSPQTKNLHWPLIDPTQAQGTPEQKMVIFRQVRDEIKKRVADL 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap