4AAY


Conserved Protein Domain Family
arsenite_ox_S

?
TIGR02694: arsenite_ox_S 
Click on image for an interactive view with Cn3D
arsenite oxidase, small subunit
This model represents the small subunit of an arsenite oxidase complex. It is a Rieske protein and appears to rely on the Tat (twin-arginine translocation) system to cross the membrane. Although this enzyme could run in the direction of arsenate reduction to arsenite in principle, the relevant biological function is arsenite oxidation for energy metabolism, not arsenic resistance. Homologs to both large (TIGR02693) and small subunits that score in the gray zone between the set trusted and noise bit score cutoffs for the respective models are found in Aeropyrum pernix K1 and in Sulfolobus tokodaii str. 7. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131741
View PSSM: TIGR02694
Aligned: 4 rows
Threshold Bit Score: 236.707
Threshold Setting Gi: 55773484
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4AAY_B       46 GVEYPANRLANISELTLNEPLDVAYPDEDAAGVLLKLGTRVEGGVGPDGDIVGFSTICPHKGFPLSYSAdnKTFNCPGHF 125
gi 55773484  34 SLTYPAVKVANLSQVKTGEPIFFNYPDASSPAVLVKLGRPAIGGVGRERDIVAFSALCTHMGCPVQYEE--GRFICRCHY 111
gi 37962696  46 GVEYPANRLANISELTLNEPLDVAYPDEDAAGVLLKLGTRVEGGVGPDGDIVGFSTICPHKGFPLSYSAdnKTFNCPGHF 125
gi 41688501  43 TLPYPITAVGKAKGLKVDAPVSFNYPDASSPCVAIKMGQPTPGGVGPNNDIVAHSILCTHMGCPVSYDAsaKTFKCPCHF 122
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|
4AAY_B      126 SVFDPEKGGQQVWGQATQNLPQYVLRVADNGDIF-AEGVDELIYGRLSNV 174
gi 55773484 112 SMFDPAKAGQPYQGLASSWLPQIPLRIDGKGDIY-AVAVAGLIWGRVKNV 160
gi 37962696 126 SVFDPEKGGQQVWGQATQNLPQYVLRVADNGDIF-AEGVDELIYGRLSNV 174
gi 41688501 123 SVFDPDNHGQMVCGQATENLPQIQLSYNAANDTFtAIGVTGLIYGRQSNI 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap