1E3P


Conserved Protein Domain Family
pppGpp_PNP

?
TIGR02696: pppGpp_PNP 
Click on image for an interactive view with Cn3D
guanosine pentaphosphate synthetase I/polynucleotide phosphorylase
Sohlberg, et al. present characterization of two proteins from Streptomyces coelicolor. The protein in this family was shown to have poly(A) polymerase activity and may be responsible for polyadenylating RNA in this species. Reference 2 showed that a nearly identical plasmid-encoded protein from Streptomyces antibioticus is a bifunctional enzyme that acts also as a guanosine pentaphosphate synthetase.
Statistics
?
PSSM-Id: 131743
View PSSM: TIGR02696
Aligned: 8 rows
Threshold Bit Score: 1338.3
Threshold Setting Gi: 38200310
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A       21 ETHYAEAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATTASKNPKDQLDFFPLTVDVEERMYAAGKIPGS 100
gi 24413893   4 ETHYAEAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATSASKNPKDQLDFFPLTVDVEERMYAAGKIPGS 83
gi 71914920   3 GVYSAEAVIDNGRFGTRTIRFETGRLARQATGSATAYLDDETMVLSATTVSKRPKEALDFFPLTVDVEERMYAAGRIPGS 82
gi 54017365  17 GVFESVALIDNGSYGTRTVRFETGRLARQAAGSVVAYLDDETMLLSATTAGKTPKDQFDFFPLTVDVEERMYAAGRIPGS 96
gi 50840552   5 GLEFTEAIIDNGKLGKHVVRFEAGLLAQQADGSAAVYLDGDTMLLSATTAAKTPRDSIDFFPLTVDVEERMYAAGRIPGS 84
gi 38200310  17 GITEAIATIDNGDFGKRTIRFETGQLARQADGSVTTYLDDDTMLLATTTASNQPREGFDFFPLTVDVEERMYAAGRIPGS 96
gi 28476429   3 DVQFSEGVIDNGRFGTRTIRFETGRLARQAQGSVVAYLDGETMLLSSTSVGKQPKEDCDFFPLTVDVEERSYAAGKIPGS 82
gi 50951092   5 EITFAEAMLDNGRFGARTVRFETGRIAQQAQGAVAAYLDEETMLLSATSASKHPKDNFDFFPLTVDVEERSYAAGKIPGS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      101 FFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQVVATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVAL 180
gi 24413893  84 FFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQVVATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVAL 163
gi 71914920  83 FFRREGRPSEDAILTCRLIDRPLRPSFQKGLRNEIQIVATVLALHPDHLYDVIAINAASMSTQLAGLPFSGPIGGVRVAL 162
gi 54017365  97 FFRREGRPSTDAILTCRLIDRPLRPSFVDGLRNEVQVVVTVLSLDPKDLYDVVAINAASASTQIAGLPFSGPVGGVRVAL 176
gi 50840552  85 FFRREGRPSEGAILACRLIDRPLRPSFVKGLRNEVQVVVTVMALNPAVYYDVVAINAASMSTQLAGLPFSGPIGGVRMAL 164
gi 38200310  97 FFRREGRPSTEAILACRLIDRPLRPTFVKGLRNEVQVVITVLSVNPQDMYDVVAINGASAATQLSGLPVSGPVGGVRMAL 176
gi 28476429  83 YFRREGRPSTEAILACRLIDRPLRPSFNAGLRNEVQVIVTVLSIAPGEFYEALAINAASASTLVSGLPFSGPIGGVRLAL 162
gi 50951092  85 FFRREGRPSTEAILVCRLIDRPLRPSFVDGLRNEVQIVVTVLSIAPDEFYDALAINAASASTQISGLPFSGPIAGVRLAL 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      181 IR---------GQWVAFPTHTELEDAVFDMVVAGRVLED-------GDVAIMMVEAEATEKTIQLVKD-GAEAPTEEVVA 243
gi 24413893 164 IR---------GQWVAFPTHTELEDAVFDMVVAGRVLED-------GDVAIMMVEAEATDKTIKLVEG-GAEAPTEEVVA 226
gi 71914920 163 VE---------GQWVAFPTHSELANATFDMVVAGRVLDN-------GDVAIMMVEAESTPHTLRLVAE-GAIGPNEQTVA 225
gi 54017365 177 IPdqgansaggGQWVAFPTVEQLEGAVFDMVVAGRVVES-------GDVAIMMVEAEATEKVIELVEG-GAQAPTEAVVA 248
gi 50840552 165 ID---------DQWVCFPSVDQRKESTFDMVVAGRVLAD-------GDVAIMMVEAESTPATWGLVRG-GRTAPTEEVVA 227
gi 38200310 177 IAdda---hpkGQWIAFPTHEQHEQALFELVVAGRIVSKkqgkktvDDVAIMMVEAGATEQVVDRVKA-GAPAPTESVVA 252
gi 28476429 163 IDg---------QWVAFPRYEDLSGAVFDLTVAGRVFVNesg---keDIAIMMVEAEATESAWDLIHShGAKKPNEEVIE 230
gi 50951092 165 IPgng---aheDQWVAFPKASQLEEAVFDLIVVGRVLTNedg--teGDVAIMMVEAEATEGSWNLIQG-GAVKPNEEVVA 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      244 AGLDAAKPFIKVLCKAQADLAAKAAKPTGEFPVFLDYQDDVLEALSAAVRPELSAALTIAGKQDRE----AELDRVKALA 319
gi 24413893 227 AGLDAAKPFIKVLCRAQADLAAKAAKPTGEFPIFLDFQDDVLEALTGAVKPELTQALTIAGKQERE----AELDRVKGLA 302
gi 71914920 226 EGLEAAKPFIKVLCRAQQTVAEAAGKPPGEYPIFIDYQDDAYAAVEEAIHDELAAALTIADKQERE----AELDRVKALV 301
gi 54017365 249 EGLEAAKPFIARLCRAQQDLAELAAKPTEEFPLFPPYGPDVYEAVEGAAEAELGEALSIAGKQERE----EKIDEIKLAV 324
gi 50840552 228 TGLEAAKPFIKVLCDAQVALAAKLPKETYDFPVFKDYEDDVYAAVEEKAADELSRIEQIAAKLERQ----EAESELKARI 303
gi 38200310 253 EGLEAAKPFIEVLCRAQAGLAERAAKETQEFPLFPPYTDVVYDAVEKKVSKKLRSLLTIKSKQDRD----EATNAYMEEI 328
gi 28476429 231 EGIESAKVFIRTLCDIQRDLASKLSLSHTEPDLYPDYSDSVHSFVEGLVKSDLEKVYRGNHDSGYApnalSASDEIKQKA 310
gi 50951092 239 QGLEAAKPFIRQLVGAQAALAKQSAKAIADYPVFLPYSQETYDSVAALAYDELVNVYQIADKVERQ----NADDALKERV 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      320 AEKLLPEFE------GREKEISAAYRALTKSLVRERVIAEKKRIDGRGVTDIRTLAAEVEAIPRVHGSALFERGETQILG 393
gi 24413893 303 AEKLLPEFE------GREKEISAAYRALTKSLVRERVIKEKKRIDGRGVTDIRTLAAEVEAIPRVHGSALFERGETQILG 376
gi 71914920 302 AEKLAEDFE------GREKELAAAFRALTRKLVRERIVKDGVRIDGRGVKDIRSLTAEVNVIPRVHGSALFERGETQILG 375
gi 54017365 325 LDRLAEQFA------GREKELGAAFRSVTKKLVRQRILTDGFRIDGRGLADIRALSAEVAVVPRAHGSALFERGETQILG 398
gi 50840552 304 KAELAETFP------EREAEISGAFKAVMKKIVRKRVLDEGVRIDGRGPRDIRSLSAEVGIIPRVHGSALFQRGETQILG 377
gi 38200310 329 EADLIAQLGsdd-eaAASKAIRAAYNAVMKKIVRHMILTEHFRIDGRGVTDIRDLGVEVDLIPRAHGSSLFERGETQILG 407
gi 28476429 311 YDAFHDAVLsgrfdqDSLSQFPHAYKAVLKDVVRTCVLEGFARMDGRGLSDIRPLDAEVQVVPRVHGSAVFQRGETQVLG 390
gi 50951092 315 KAALAEKAQagaldaEALTQFSAAYKSVSKVVMRGRVLREGVRIDGRGLTDIRPLDAEVQIIPRVHGSAVFQRGETQILG 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      394 VTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSEAL 473
gi 24413893 377 VTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSEAL 456
gi 71914920 376 ITTLNMLRMEQTIDTLNPERTKRYMHNYNFPPYSTGETGRVGAPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEAI 455
gi 54017365 399 VTTLDMVKMAQQVDSLGPETSKRYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALIPVLPSQEDFPYAIRQVSEAL 478
gi 50840552 378 VSTLNMLDMEQKLDTLSPENTRRYMHNYNMPPYSTGETGRVGSPKRREIGHGNLAERALIPVLPTREEFPYAIREVSEAI 457
gi 38200310 408 VTTLDMLKMEQQIDSLTPATSKRYIHHYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVIPSREEFPYAIRQVSEAL 487
gi 28476429 391 VTTLNMLKMEQQIDSLAPIVSKRYIHHYNFPPYSTGEVGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEAL 470
gi 50951092 395 VTTLNMLKMEQQIDSLSPVTKKRYLHHYNFPPYSTGETGRVGSPKRREIGHGFLAERALVPVLPSREEFPYAIRQVSEAL 474
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      474 GSNGSTSMGSVCASTMSLLNAGVPLKAPVAGIAMGLISQ-EING-----ETHYVALTDILGAEDAFGDMDFKVAGTKEFV 547
gi 24413893 457 GSNGSTSMGSVCASTMSLLNAGVPLKAPVAGIAMGLISQ-EING-----ETHYVALTDILGAEDAFGDMDFKVAGTKEFV 530
gi 71914920 456 GSNGSTSMGSVCASTMSLMAAGVPLKDMVAGIAMGLIYE-DGK---------YVTLTDILGAEDAYGDMDFKVAGTRDLI 525
gi 54017365 479 GSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSD-TVTNdkgeqEVRYVALTDILGAEDAFGDMDFKVAGTREFV 557
gi 50840552 458 GSNGSTSMGSVCASTLALLNAGVPLRASVAGIAMGLMSEtDEDG-----KTKYLALTDILGAEDALGDMDFKVAGTSEFV 532
gi 38200310 488 GSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSD-EVDG-----ETRYVALTDILGAEDAFGDMDFKVAGTRQFI 561
gi 28476429 471 GSNGSTSMGSVCASTLSLLNAGVPLRAPVAGIAMGLISG-RVDG-----EMRYVTLTDISGSEDALGDMDFKVAGTSDFI 544
gi 50951092 475 SSNGSTSMGSVCASTLSLLNAGVPLRAPVAGIAMGLISD-VIDG-----ETRYAALTDILGAEDALGDMDFKVAGTSEFV 548
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      548 TALQLDTKLDGIPASVLAAALKQARDARLHILDVMMEAIDTPDEMSPNAPRIITVKIPVDKIGEVIGPKRQMINQIQEDT 627
gi 24413893 531 TALQLDTKLDGIPASVLAAALKQARDARLHILDVMMEAIDTPDEMSPNAPRIITVKIPVDKIGEVIGPKGKMINQIQEDT 610
gi 71914920 526 TALQLDTKLDGIPAEVLASALQQARGARLAILDVMSEAINRPAEISPHAPRILTVKVPIDKIGEVIGPKGKMINSIQDET 605
gi 54017365 558 TALQLDTKLDGIPSQVLAGALSQAHDARTTILDVMAEAIATPDEMSPYAPRVTAIKIPVDKIGEVIGPKGKVINQITEDT 637
gi 50840552 533 TALQLDTKLDGIPADVLAGALKQAKEARTAILEVMNEAIDSPDEMAPTAPRIITVHIPVDKIGEVIGPKGKMINQIQDDT 612
gi 38200310 562 TALQLDTKLDGIPSEVLAQALSQANDARNTILDTMAEVIETPDEMSDYAPRITAITVPVNKIGEVIGPKGKTINSITEET 641
gi 28476429 545 TALQLDTKLDGIPAHVLSEALAHARSARLAILDVLTRVIDSPDQMSEYAPRVVRVKIPVQKIGELIGPKGKVINSIQDET 624
gi 50951092 549 TAIQLDTKLDGIPSSVLASALKQAKDARTTILSVLDAAIDAPDEMAPTAPRVISVQIPVDKIGELIGPKGKTINAIQDET 628
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E3P_A      628 GAEITIEDDGTIYIGAADGPAAEAARATINGIANPTSPEVGERILGSVVKTTTFGAFVSLLPGKDGLLHISQIRKLAGGK 707
gi 24413893 611 GADITIEDDGTIYIGAAQGSQAEAARATINGIANPTMPEVGERYLGTVVKTTTFGAFVSLLPGKDGLLHISQIRKLAGGK 690
gi 71914920 606 GAEITIEDDGTIYIGATDGPSAEAARDAINSIANPTMPEVGERYLGTVVKTTAFGAFVSLLPGKDGLLHISQIRKMHGGQ 685
gi 54017365 638 GANISIEDDGTVFVGATDGPSAQAAIDAINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHIS---KLGNGK 714
gi 50840552 613 GANISIEDDGTIFIGADNGDSAESARSMINAIANPQMPEVGERYLGTVVKTTSFGAFVSLLPGKDGLLHISKMRDLNDGK 692
gi 38200310 642 GANISIEEDGTVYVSAASGAAAEAAIEKINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHIS---KLGGGK 718
gi 28476429 625 GAEISIEDDGTVYIGSSQADSSEKAVAMVNSIVNPVEPCVGSQFLGTVVKNMPFGSFISLVPGKDGLLHISEIRKMVDGR 704
gi 50951092 629 GADISIDEDGTVYIGAVDGPSAEAARAQVNVIANPTNPEVGEQFLGTVVKNAAFGAFVSLLPGKDGLLHISEVRKLAGGK 708
                       730       740       750
                ....*....|....*....|....*....|..
1E3P_A      708 RVENVEDVLGVGQKVQVEIAEIDSRGKLSLIP 739
gi 24413893 691 RVENVEDVLGVGAKVQVEIAEIDSRGKLSLIP 722
gi 71914920 686 RIENVEDVISIGEKIHVEVRDIDERGKLSLVP 717
gi 54017365 715 RVAKVEDVVNVGDKLRVEIADIDNRGKISLVP 746
gi 50840552 693 RVEAVEDVLSVGQKIQVEIAEVDDRGKLSLVL 724
gi 38200310 719 RIEKVEDVVNVGDKLEVEILDIDNRGKISLAP 750
gi 28476429 705 HLESVDEVLSVGQKVLVEVSKIDDRGKLCLVA 736
gi 50951092 709 RVESVDDVLSIGQKILVEITKIDDRGKLSLAP 740
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap