Conserved Protein Domain Family
archaeo_AfpA

?
TIGR02699: archaeo_AfpA 
archaeoflavoprotein AfpA
The prototypical member of this archaeal protein family is AF1518 from Archaeoglobus fulgidus. This homodimer with two non-covalently bound FMN cofactors can receive electrons from ferredoxin, but not from a number of other electron donors such as NADH or rubredoxin. It can then donate electrons to various reductases. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131746
View PSSM: TIGR02699
Aligned: 4 rows
Threshold Bit Score: 302.117
Threshold Setting Gi: 2621783
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2621783    6 SVAWCITGAGEKLTETYAIMKDVKKIYGDrvKIDVFISKAGDQVVKYYGLYRDLETSFDRKWVEINANSPFLAGQVQLGK 85
gi 2649043   11 RVAWGITGSGDRLPETVDVMLEVKKEFPDv-EIAVYLSKAGAQVVKYYKLMDTLKENFGAVRVEIDANTPFLAGQIQVGR 89
gi 2496114    3 KIAWGITGCGDKLPEVVEIMKKLKNKYNL--DVDIYLSKNAKIVVKWYKLWQVLEDEFYDLRVEVNANAPFLVGKLQTGK 80
gi 20905027  11 RIAWGITGSGDQMIETYSILVDIKNRTGV--ETMVFLSKEGETVMKWYHLWDKIQNDFPNFKVDAGPNSPFIAGPLQMGY 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2621783   86 YDFILVAPCTSNSTAKISLRIGDTLVTNAVIMAQKASVPVYIMPSDYSEGKVVTTLPNGKKLELRITKEDVEHVKKISKM 165
gi 2649043   90 YEFLLIAPATSNTVAKIAMGIADSLLANAAIMGLKAYVPLYIMPSDYKEGEVITKLPDGRDLRLRVRKEDVEHVRKLAQM 169
gi 2496114   81 YDLFLVAPATANTTAKIAYGIADTLITNSVAQAMKAKVPVYIFPPDNKKGTVETILPGNKKLTLYMRDVDVENVERLRRM 160
gi 20905027  89 YDFLLIAPATANTVAKIVYGIADTLVTNAVSQTAKGKTPIFILPVDQKRGTVKTAAPSGRAFELTMREVDVTNSEKLAQM 168
                       170
                ....*....|....*.
gi 2621783  166 DRTEVFSDPQKIYKIF 181
gi 2649043  170 DGVTILEKPEDIPKVF 185
gi 2496114  161 EGIEVLDKPEDIEKVI 176
gi 20905027 169 ENINILTSPYEIYDIF 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap