Conserved Protein Domain Family
flavo_MJ0208

?
TIGR02700: flavo_MJ0208 
archaeoflavoprotein, MJ0208 family
This model describes one of two paralogous families of archaealflavoprotein. The other, described by TIGR02699 and typified by the partially characterized AF1518 of Archaeoglobus fulgidus, is a homodimeric FMN-containing flavoprotein that accepts electrons from ferredoxin and can transfer them to various oxidoreductases. The function of this protein family is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 131747
View PSSM: TIGR02700
Aligned: 3 rows
Threshold Bit Score: 403.099
Threshold Setting Gi: 2494448
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494448   10 KIVWCITGAGHLLRESFQVMKRLKEEIEDLKVTTLVSRAGEEVVKMYGLFGELYNISNGNYYEELILEREHPYSSPITGR 89
gi 20906380   5 RIAWGITGAGHFLDRSYQVFKELKLRNPELSVNTYVSRAAEEVLRMYGLEQKLVKISGGDYLEEIFRESEQGSSSPKVGR 84
gi 19888159   4 RIGWGITGAAHLLVETFKIMKEISR---EHRISAFLSEAGEEVVRMFGLWDDLREICPGGFYREVFTQSEEGASCPIIGR 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494448   90 LSLGKYDYLICSPATGNTVAKVVNGIADSLVTNAIAQAGKGFVKSLIVPVDYKAGIVTtKLPYAIDKKKCKLCLKCIN-- 167
gi 20906380  85 FALDRYDALFVTPATSNTVSKIAYGIADSLVTNAVSQAVKGRVPVFVVPVDIEGSIIS-EMPYNIDRKQCKHCETCPPre 163
gi 19888159  81 FALGKYDLLIVSPATANTVAKIAHGIADTLVTNAVAQAGKGDVPVWVVPCDYEEGKIRtITPYMVLRERCEGCGICVD-- 158
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2494448  168 VCPNGAIVKRDNFV-EILLSKCLGCGNCKKVCPYNAIIEGkEIKMRVRKIDAENTRKLMELEDVIVLKHPYEILEFF 243
gi 20906380 164 NCPHEAISEKNGVTdQIDLLKCKGCGICKELCPYNAIKGG-PVEVLVRDVDMRNVEIVKSLQGITVLESPEAILELF 239
gi 19888159 159 ACPRSAIDMVDGKA-FIRLLRCVGCGKCAEACPEDAIHGGlEYEMRVRSVDAENVRKLERIEGIEVLRHPEEIPERL 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap