Conserved Protein Domain Family
SufR_cyano

?
TIGR02702: SufR_cyano 
iron-sulfur cluster biosynthesis transcriptional regulator SufR
All members of this cyanobacterial protein family are the transcriptional regulator SufR and regulate the SUF system, which makes possible iron-sulfur cluster biosynthesis despite exposure to oxygen. In all cases, the sufR gene is encoded near SUF system genes but in the opposite direction. This DNA-binding protein belongs to the the DeoR family of helix-loop-helix proteins. All members also have a probable metal-binding motif C-X(12)-C-X(13)-C-X(14)-C near the C-terminus. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131749
View PSSM: TIGR02702
Aligned: 4 rows
Threshold Bit Score: 336.031
Threshold Setting Gi: 22294212
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17131583   8 STKQEILEYLLKHSQATALDLANVLDVSPQAIRRHLKDLETEELVVYSNTMQAgMGRPQHVYQLSRQGRERLHKnv---- 83
gi 1001704   32 STKEDILCYLLKEGQGSAIAMAEELGISPQAMRKHLKDLENDGLIEHQQERQS-MGRPQFLYQLSKQGREQFPQ------ 104
gi 56687326   8 TTKEAILSLLLEQGQATSAAIAEALAISLQAVRRHLKDLATEGLIEQEAVVAG-LGRPQYHFRLSRQGRSQFPS------ 80
gi 22294212   6 DTKQDILHCLLRDGHLSAQELAAQLAISPQAVRRHLKDLEAEQLVTYK-VLSGtVGRPQYRYTISEAGREELRQlqlrqq 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17131583  84 sdRHGDFAVSLLDTLAETVGHDQFKTILQKQWERKAQEYRDRVGKGSLQERVANLVELRKNEGFMAEYHPVDsseSTQKE 163
gi 1001704  105 --RYGEFALSFIDSLVETVGEEQLGAVLKKQWQRKAEAYRQQIGQGPLSKRVHKLVELRRQEGYMAEIHPLS---VEQAE 179
gi 56687326  81 --SHDRFAVDLLDSLSEMLPPQEFEAVLAHQWRRKAETYRRQLGQGSLADRLQQLAALRQAEGFMAEVHPAP---DRSPP 155
gi 22294212  85 atHPKGFALELLESVAATLGPEQMQDVLQAAWQRKALAYREQMGSGTLAERLARLVALRQQEGYMAEFYPVS----EPKG 160
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*
gi 17131583 164 RFIFIEHNCAISNVAESFPSVCGHELEMFAAVLPDCTVERTHWLINGEHRCGYLV 218
gi 1001704  180 KFILSEHHCAIADVAESYPTVCGHELEMFAAILPDCAIERTHWLNDGEHTCGYLI 234
gi 56687326 156 AFVITEYNCAIASVAESFPRVCDHELALFAETLPDCHVERTHWLIDGEHRCGYLI 210
gi 22294212 161 AYLLTEYNCAISAVAQSFPTVCHHELEMFAIALGDCAVERTHWLVDGEHRCGYLI 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap