Conserved Protein Domain Family
nudix_YtkD

?
TIGR02705: nudix_YtkD 
nucleoside triphosphatase YtkD
The functional assignment to the proteins of this family is contentious, with papers disagreeing in both interpretation and enzyme assay results. This protein belongs to the nudix family and shares some sequence identity with E. coli MutT but appears not to be functionally interchangeable with it. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131752
View PSSM: TIGR02705
Aligned: 7 rows
Threshold Bit Score: 231.495
Threshold Setting Gi: 56381235
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56910891   2 EQFIDPQGQKVKLVLGKEErFTEEAGHVLVLPRFQQQWVLTEHRDRGYEFPGGKVENGETTKDAAIREVWEETGAHIGTI 81
gi 10175931   2 DVFNDYYGYPVRLAFDSTP-FSINPRHVWVICHMDGQWLLTNHKKRGLEFPGGKVEHGETPEAAAIREVKEETGATVRSL 80
gi 56381235   2 HEFRDYYGHRVRLAFADHP-FSPSPGHVWVICRYGGRWLLTDHPRRGLEFPGGKVEEGETAAEAAAREVMEETGGIVGRL 80
gi 51974180   2 YKFKDYYHNTVQLSFERYP-FSPEPKHVWVVCRYGDQWLLTHHLRRGLEFPGGKVELGETPEEAAVREVHEETGGIVSDL 80
gi 16411105   2 FIYIDTLGNKVTIYFEAQE---NNPDDVLIIPKTKDGWLFTEHKIRGLEFPGGKGEPGETNLDAAKRELMEETGAISAEL 78
gi 49245056   3 VKFRDKDNRQVNLTFKKDN-EIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGESSAEAVTRELYEETGAKVKNI 81
gi 27315926   4 VEFEDKDGRIVTLNYKNEN-DMPNGNHVLAIPVYNNQLLFTNHQHRGIEFPGGKVEISEQSKEAVIRELYEETGAIAKFI 82
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 56910891  82 VYIGQYQVEGQSgTSFCKDIFAGIVTDMEEKDCYKETKGPLLLKELPAALKEDPRFSFIMKDEVVPKATAYAIGQGIL 159
gi 10175931  81 TFLGQYEVTLPS-ERIVKNIYAADVQALSSRNSYYETNGPVKIAELPEAIEKDPSFSFIMKDLVLRKTLDYLKRKQLF 157
gi 56381235  81 EYIGQYEVEP----DIVKNMYFADIAALVERGSYLETNGPVLLEALPDDIRADQRFSYFMKDDVLSLALAKLKQRGLI 154
gi 51974180  81 TYLGQYKVSGKD-KIIIKNIYFATISAVEQHTHYEETKGSVLLTDIPDNIKTDRKFSFIMRDDVLARTMKHIEEIGCF 157
gi 16411105  79 HFVADYLVESEE-RTFTKRVYAAHVISIESLDDYLETKGPVIIQGELSQFILQPAFSFFMRDAGMIQIVQQAEHILND 155
gi 49245056  82 HYIAQYTIETHDqTDFVKDVYFIEVESLVSKNDYLETAGPVLFNCINDIELAQR--SFLLQDSTILKCVERVQSLGFY 157
gi 27315926  83 YYFAQYSIKMGHdEPFIKDVYFVEVSHLEYVDTYYETLGPCLYHQINDIPLNKR--SFLINDKAILHCLERVKTLGFY 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap