2DU2


Conserved Protein Domain Family
L_lactate_ox

?
TIGR02708: L_lactate_ox 
Click on image for an interactive view with Cn3D
L-lactate oxidase
Members of this protein oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide. The enzyme is known in Aerococcus viridans, Streptococcus iniae, and some strains of Streptococcus pyogenes where it appears to contribute to virulence. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131755
View PSSM: TIGR02708
Aligned: 4 rows
Threshold Bit Score: 698.588
Threshold Setting Gi: 119389267
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2DU2_A        7 EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIK 86
gi 14972189   2 SYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFTLRENIRAFNHKLIVPHTLCNVENPSTEIEFAGEKLS 81
gi 71852936  17 DFKTSSAEGNVDFINVFDLEKMAQQVIPKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDYLT 96
gi 849022     7 EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIK 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2DU2_A       87 APFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGA 166
gi 14972189  82 SPIIMAPVAAHKLANEQGEVATARGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGY 161
gi 71852936  97 SPLILAPVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDDGINRNIMDRVKAQGC 176
gi 849022    87 APFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGA 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2DU2_A      167 TAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRgTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHP 246
gi 14972189 162 KAIVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLP-EGAGKSMDFVYKSAKQRLSPRDVEFIAEYSGLPVYVKGPQCR 240
gi 71852936 177 KAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLP-DGAGKTMDYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCA 255
gi 849022   167 TAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRgTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHP 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2DU2_A      247 EDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGL 326
gi 14972189 241 EDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAVDRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGL 320
gi 71852936 256 EDTLRALDAGASGIWVTNHGGRQLDGGPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGL 335
gi 849022   247 EDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGL 326
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
2DU2_A      327 ALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY 374
gi 14972189 321 ALGGSVGVRQVFEHLNAELKTVMQLSGTQTIEDVKHFKLRHNPYNPTF 368
gi 71852936 336 AMGGSIGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSI 383
gi 849022   327 ALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap