Conserved Protein Domain Family
symport_actP

?
TIGR02711: symport_actP 
cation/acetate symporter ActP
Members of this family belong to the Sodium:solute symporter family. Both members of this family and other close homologs tend to be encoded next to a member of pfam04341, a set of uncharacterized membrane proteins. The characterized member from E. coli is encoded near and cotranscribed with the acetyl coenzyme A synthetase (acs) gene. Proximity to an acs gene was used as one criterion for determining the trusted cutoff for this model. Closely related proteins may differ in function and are excluded by the high cutoffs of this model; members of the family of phenylacetic acid transporter PhaJ can score as high as 1011 bits. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131758
View PSSM: TIGR02711
Aligned: 4 rows
Threshold Bit Score: 953.986
Threshold Setting Gi: 418555
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748   4 RFMMLFGLLTLPVLAWAADALTGDVQRQPLNIQAIVMFLLFVGGTLYITYWASKKTRSRSDYYTAGGNITGFQNGLAIAG 83
gi 418555     2 KRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSRSDYYTAGGNITGFQNGLAIAG 81
gi 62899804   4 RHWSALSLFVLPALAQA-EALTGEVHRQPLNIQAIVMFLLFVGGTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAG 82
gi 62899769   2 KNFLLLAIMLFPHLTWA-NVISETGERQPVNIQAIIMFVLFVGFTLYITYWASKKTRSRTDYYTAGGRITGFQNGMAIAG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748  84 DYMSAASFLGISALVYTSGYDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQNPIRSLSACGSLVVVALY 163
gi 418555    82 DYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALY 161
gi 62899804  83 DYMSAASFLGISALVYASGYDGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALY 162
gi 62899769  81 DFMSAASFLGISALVYTSGYDGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRILSAIGSLFVVALY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748 164 LIAQMVGAGKLIELLFGLNYHVAVVLVGILMVMYVMFGGMLATTWVQIIKAVLLLFGATFMAVMVMKSVGFSFDALFKQA 243
gi 418555   162 LIAQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSEA 241
gi 62899804 163 LIAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATFMAIMVMKSVNFNFNTLFSEA 242
gi 62899769 161 LIAQMVGAGKLIELLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGATFMALMVMKIVNFNFNTLFKEA 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748 244 MEVHPKGAAIMSPGGLVSDPISALSLGLGLMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFMGYFYFLTFIIGFGAIL 323
gi 418555   242 MAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIM 321
gi 62899804 243 VKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAIL 322
gi 62899769 241 IAVHSRGEAIMSPGGLVSDPISALSLGLALMFGTAGLPHIIMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAIL 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748 324 LVSANPEFKDATGALIGGNNMAAIHLADAVGGNFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYSNVIKKGkATERD 403
gi 418555   322 LVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATERE 400
gi 62899804 323 LVGPNQTFKDAAGALLGGNNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGkANERD 402
gi 62899769 321 LVSPNPSFKDTTGALIGGTNMAAVHLASAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANAIKSGkANERD 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62899748 404 ELKVSKITVLVLGVVAISLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWSKLTTRGAMIGGWAGLLTAVILMVLGP 483
gi 418555   401 ELRVSKITVLILGVIAIILGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGP 480
gi 62899804 403 ELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKLTTRGAMIGGWLGLSTAVILMILGP 482
gi 62899769 401 ELRVSKITVVILGFIAIGLGILFENQNIAFMVGLAFSIAASCNFPIILLSMYWHKLTTRGALVGGWLGLITAVVLMILGP 480
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 62899748 484 TIWVKILGHAAPIYPYDYPALFSMLVAFIGIWFFSITDRSETGQQERARFHAQFVRSQTGVGASKGSSH 552
gi 418555   481 TIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTGFGVEQGRAH 549
gi 62899804 483 TIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFSITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH 551
gi 62899769 481 TIWVSILGHEKPIYPYEYPALFSMIIAFIGSWLFSITDNSQQGMQEREQFRIQFIRSQTGLGIAQGKTH 549
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap