1X19


Conserved Protein Domain Family
C20_methyl_CrtF

?
TIGR02716: C20_methyl_CrtF 
Click on image for an interactive view with Cn3D
C-20 methyltransferase BchU
Members of this protein family are the S-adenosylmethionine-depenedent C-20 methyltransferase BchU, part of the pathway of bacteriochlorophyll c production in photosynthetic green sulfur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produced bacteriochlorophyll d. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131763
View PSSM: TIGR02716
Aligned: 3 rows
Threshold Bit Score: 308.133
Threshold Setting Gi: 21645919
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1X19_A       42 LIEFSCMKAAIELDLFSHMAEGPKDLATLAADTGSVPPRLEMLLETLRQMRVINLEDGKWSLTEFADYMFSPTPKEPNLH 121
gi 10198169  37 TVDFFVIKAAKDLGLFDLLASAPRTLADLATLTETVPPRLEKFLITMEQIGLVTRQGDAWQLTPFADQFFADPERHRNMT 116
gi 21645919  21 LIEFSCMKAAIELDLFSHMAEGPKDLATLAADTGSVPPRLEMLLETLRQMRVINLEDGKWSLTEFADYMFSPTPKEPNLH 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1X19_A      122 QTPVAKAMAFLADDFYMGLSQAVRGQKNFKGQVPYPPVTREDNLYFEEIHRSNAKFAIQLLLEEAKLDGVKKMIDVGGGI 201
gi 10198169 117 MVPFVDYIADLIENYYLRLADVVRGKVDFTSIVPHPPRTREDSLFYETLHRSNIQLFTELLIKRARLADVQTLIDVGGGI 196
gi 21645919 101 QTPVAKAMAFLADDFYMGLSQAVRGQKNFKGQVPYPPVTREDNLYFEEIHRSNAKFAIQLLLEEAKLDGVKKMIDVGGGI 180
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1X19_A      202 GDISAAMLKHFPELDSTILNLPGAIDLVNENAAEKGVADRMRGIAVDIYKESYPEADAVLFCRILYSANEQLSTIMCKKA 281
gi 10198169 197 GDIAAALCQAFPQLKVTLINLPSALDLVRENVAAKGLADRITPVAIDMYREPYPPGDAVLFSRILYPMNAQFCTMLLRKA 276
gi 21645919 181 GDISAAMLKHFPELDSTILNLPGAIDLVNENAAEKGVADRMRGIAVDIYKESYPEADAVLFCRILYSANEQLSTIMCKKA 260
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
1X19_A      282 FDAMRSGGRLLILDMVIDDPENPNFDYLSHYILGAGMPFSVLGFKEQARYKEILESLGYKDVTMVR 347
gi 10198169 277 YDALPSGGRILILDMVISDPNHPNYDYLTHYLCAIGMGFSVLEFKDHAVYPDLLRQVGFTDVTLDE 342
gi 21645919 261 FDAMRSGGRLLILDMVIDDPENPNFDYLSHYILGAGMPFSVLGFKEQARYKEILESLGYKDVTMVR 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap