Conserved Protein Domain Family
AcCoA-syn-alpha

?
TIGR02717: AcCoA-syn-alpha 
acetyl coenzyme A synthetase (ADP forming), alpha domain
Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff.
Statistics
?
PSSM-Id: 131764
View PSSM: TIGR02717
Aligned: 12 rows
Threshold Bit Score: 612.007
Threshold Setting Gi: 56312692
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56312692   13 LHDFLAPGSIAIIGASTDPTKRGYKAMVGLIKDgYPGAIYPINPKVD--NVLG--VRTYATLDDI--PGPVDLALICTPA 86
gi 55230447    4 LSTLFAPERVAVVGATDSEGSVGHAVTTNLLDS-FTGEVVAVNPNKE--TVLG--LPCYDNLARLddPGSVDVAVVVVPP 78
gi 2649370     1 MERLFYPKVVAVIGASPQEGKVGNTIMKNLRN--FSGTVYAVNPKYR--EILG--FPCYPSVLKI--PENVDLAIIVVPA 72
gi 2496062     8 LKYISYPKSVAIIGASKTEGKVGYAIMKNLKDFn--GKIYPINPKYD--EIFG--IKCYKSVLDV--EDDIDLAVIVVPN 79
gi 18893678    3 LEALFNPKSVAVIGASAKPGKIGYAIMKNLIEYgYEGKIYPVNIKGGeiEINGrkFKVYKSVLEI--PDEVDMAVIVVPA 80
gi 14325495    3 LKKLFYPDSVAVIGASNDNTKIGYQIIRNLKEGgYKGKIYPINTKDG--TILG--YKAYPSILDV--PDEVDLAILSIPA 76
gi 27983596    1 LAFFTNPTSIAVIGASSAAGKVGYTVVDNIKTSgYTGKVYPINPKAP--EING--FKAYPNITAC--PETPELAVFVIPA 74
gi 9502268     3 FEPLFNPKSVPVIGASDRKESVGYAVMNNMIKGgYKGNLYPVGRKP---ELFG--KKCYAKIGKI--EEKVDLAVIAIPA 75
gi 2649053   191 LKHFFNPESVAVIGASRDVEKVGGRTFYNLLTYrFNGVAYPVNRAAK--AIMG--VRAYPTISEV--PDEVELAVLSVPV 264
gi 15622618    3 LEYLFKPKSIAVIGASRYKEKVGNVVFRNLLYT-YHGKLYPVNSKAE--DVEG--VKAYKSVKEI--PDPIDMVVITVPR 75
gi 50875547    2 LEHLFSPNKIAVIGASRQVGAVGHDIVKNLIEGgFAGEIIPVNPAGG--TLLG--LPVYTSLKEY--KESLDMAIIAVNK 75
gi 499662478  16 VAKLLNPRSIAVIGASEKPEKLGNAILRNIVSG-YKGEVFGVNPRVK--KIQE--IEVYPDVFSL--PYPVDLAVIVLPA 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56312692   87 ATVPGLVADCGRKGVKGAAILASGFRETGPAGARLEQQVLAAAREGGVRLIGPNTSGMFNLH---KKVNLLALANVKPGN 163
gi 55230447   79 TVAVEVIENAGEAGIENVVVITAGFGETGSDGAEREKRLREAASEYDLNLVGPNSLGVMSTPv--GLNATFGNEMASDGD 156
gi 2649370    73 KLVPKAVEECGRKDVEGAVVISAGFKEAGIEGAKLERELVEVAERYGVKLVGPNCLGMINTEi--AMNATFSRVAPEKGR 150
gi 2496062    80 IVVPKVLEECGKKGVKGAVIITAGFSEVGN--YELENKIKEIAKRYNIRIIGPNCLGIMNTHi--NLNATFAKVFPPKGG 155
gi 18893678   81 KFVPQVLEECGQKGVKVVPIISSGFGELGEEGKKVEQQLVETARKYGMRILGPNIFGVVYTPa--KLNATFGPTDVLPGP 158
gi 14325495   77 KYTPQAAEECGRKGVFGIIVVASGFSEVGN--KDLEDQLANTCKKYGVRLLGPNVVGLMNNVi--KLNASFAPYLPYPGT 152
gi 27983596   75 KHCLATAEECGQKGVRGCVIISAGFKEVGGDGIELEQKLVAIGKKYDMRIVGPNVLGVSTP----SFNCTFASRHPRKGP 150
gi 9502268    76 KFVPGVCIECGEAGVKGLIIITAGFAEAGEEGKKMCIEIQATCQKYNMRMIGPNCLGIINPRd--GVNASFASVMPEAGG 153
gi 2649053   265 KYALEVAEECGKKGVKALLVLTAGFAEVGGEGVERQKKLVEICRKYGMRLIGPNCMGIINTApetRLLATFAPTPPNEGS 344
gi 15622618   76 EAVPQVMEEAVEKNVKAAIVITAGFKEVGE--AELEDKVISIARKGGIRVLGPNTFGIITP----EFNATFAYTDVKRGN 149
gi 50875547   76 DLIIDVVQDALSKRCTTIVAIGAGFKESGDEGAMLEQEVLTLCKRSGARLLGPNCLGFINTEl--KINASFAGPMPRKGG 153
gi 499662478  89 EKAVVALKEAAEAGVKSAVVISGGFKETGNEGALLEEEIKKIALDFEMPVLGPNCVGIVNNNl--QLNATFLRTAPLKGE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56312692  164 IGFISQSGNMLLSLVLEAEHNgHVGFSTYVGPGNQTDIGFNDYLRYLGEDPDTRVATFYVEGFRDGQRFLHNAREITAVK 243
gi 55230447  157 ISFMSQSGAFITAVLDWAAER-DVGFKDIVSLGNKAVLDESDFVAEWGDDPDTDVILGYLEDINDGSSFVQTAREVTQET 235
gi 2649370   151 IAFLSQSGAFILAVLEWSKRN-GVGFSKVVSLGNKAMLDESDFLEYLAKDDSTDVILIYMEGVEDGRKFMRVAKSVARRK 229
gi 2496062   156 VSIISQSGAVLNAILDIAPLL-NIGFSKVVSIGNKADIQESDLLEYFLDDEDTKIVVLYIEGLKD-KRFLKVAKKLSKKK 233
gi 18893678  159 LALISQSGALGIALMGWTILE-KIGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKK 237
gi 14325495  153 IGMISQSGALIVGLDAMTWAN-KTGTSFLISIGNMADLDFSDLVTFLADDENVSCISLYAEGLKAGRKFVDTARLIN--K 229
gi 27983596  151 IAFLSQSGAMLTSILDWSFAN-NIGFSNFISLGNKCDVHETELIEEVCEDDNTKIILLYLESIVDGPAFLERVSVASRKK 229
gi 9502268   154 VAFISQSGALCTAILDWAANQ-HVGFSYFVSIGSSIDTDYADLFEFFAKDPKVTSILMYIESIKDAKKFVLRAREFAADK 232
gi 2649053   345 IAFASQSGAVGLALMDRVNNY-GLGLSYFVSLGNSADITSNDLIEFWEEDGRTKLIMLYQESIPNPRKFARLAKRISKKK 423
gi 15622618  150 IALVVQSGGLGVYMLNWAQKY-RVGISYMVSLGNQADVKEYEVIEYLSRDPETRAIFVYLEGVSDGNSFLETLPEATKRK 228
gi 50875547  154 ISIFSQSGALATAMLDQAEQR-GLGVSKLISVGNKADITENDLLSYFAADSSTKVVAGYLENIVNGNNFLKHATHISRKK 232
gi 499662478 167 IAFVSQSGAILSTVLEWSLKE-DLGFSYMISMGNKAVLNEADFLPAIANDPGTAVILLYIEDVVEGSSFLKKAYEASLLK 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56312692  244 PVVVYKSGATEQGKKAASSHTGALAGSY-AMTVDLLRQVGVSVVQHSNEILPVAEGLGLLQHAp-----GKRVAVVSDGG 317
gi 55230447  236 PIVLVKSGRTDAGASAAASHTGAMAGSE-RAYEAGLDKAGTLRVESVQELFDYAQILAGQPLPd-----GDEIAIVTNAG 309
gi 2649370   230 PVVVMKAGKSQSGAKAASSHTGSLAGSY-EAYRAAFRQSGVIEASSVEELFDFALLLLKYRKAg-------NLAILTNSG 301
gi 2496062   234 PIIALKSGRTEVGKKAAKSHTGSLAGED-VIYEAAFKEAGIIRAYTFEELVDLIHLFSTQPTIs-----SNEIGIITNAG 307
gi 18893678  238 PIIVIKAGRSERGAKAAASHTGSLAGSD-KVYSAAFKQSGVLRAYTIGEAFDWARALSNLPEPq-----GDNVVIITNGG 311
gi 14325495  230 PIVMLKSGVSKHGSVAAASHTGSLAGSH-RVYDGALKQAGVIRAYSIEELFDLSLTLSLQKPMk-----GDNLIVVTNGG 303
gi 27983596  230 PIIILKSGTSLAGAAAASSHTGALAGND-IAFDLAFAQAGVIRAKTMSELFSLARLFSNTNFNtlkavqDRKFVIITNAG 308
gi 9502268   233 PIILLKAGKSSEGAAAAMSHTGSLAGND-AVYDAVFDRCGCIRVDSICDLWDCAHVLATQNIPq-----NNRLCIITNAG 306
gi 2649053   424 PILAIASGVTPAGAKAVASHTGAIVSSSgIAIDALFKQTGIIRASSIDELFSISEFLLHQPLPk-----GNRVCIVTNGG 498
gi 15622618  229 PVVFLKGGTTSNGAAAAKTHTGSLAGSF-EVFKAAVRTVGGILVDNLHDMLNLAKLLMYSEPV------TEELLVITNSG 301
gi 50875547  233 PVILLKSGTSEAGQKSATSHTGAFTGTD-TAYGAAFKRAGIVRADNFDDLFDCTMAFSNQPLPk-----GNRVLIISNAG 306
gi 499662478 246 PVVVFKAGISTAGAKAASSHTGALAGSI-EGYKLAFAKTGLIRAKTLEEMFIYARVFASGQKVt-----GKNIGIVTNSG 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56312692  318 GQATIASDRIIEAGLELAELGEATKKRLGAILLPQASPVNPVDVAGssDANPALLADCLAIVADDDNVDAVFLVGMFGgY 397
gi 55230447  310 GPGVMTTDAVGDSDLQLAQFGDKTFSRLREEMPDEANIYNPVDIIG--DAPAERFETALETVLADDNVSMAVVVACPT-A 386
gi 2649370   302 GPGVMAADACDQFGVPLANFNFETIRKLKEFLPAESNFYNPVDILG--DASAERFSRSLQILSEDENVDIVLTILTPT-A 378
gi 2496062   308 GFGVLAADSCVDYNMKLSNFEKSTIEKLKNILPPTANISNPLDIIG--DATPERYKKVIEVLAEDSNVKGLLVILTPQ-E 384
gi 18893678  312 GIGVMATDAAEEEGLHLYDNLEELK-IFANHMPPFGSYKNPVDLTG--MADGKSYEGAIRDALAHPEMHSIAVLYCQT-A 387
gi 14325495  304 GIGVLATDQAEASGLPLQTPSNDLQGKIKQIIPSFGSTKNPIDMSA--MATPQIYADTIKTVMEDESVDGLVVLYCEV-A 380
gi 27983596  309 GPGIIATDAFETFGVSLSQMTEATKDALRKALPEEASVKNPVDVIG--DATPDRYAKAMEIAFTDPNVDGCLVLVTPQ-A 385
gi 9502268   307 GPGVISTDRLVSVHGHLAKLSESTMNELNAFLSPFWSHSNPVDVLG--DATAGVYQKTLDIVIKDPQIDGVVVVLTPQ-A 383
gi 2649053   499 GLGAITSDWCHQVGLEIAELSERTQESLRNLLPEIASVKNPVDMTA--SADVRMYGQTLKTVAEDENVDAIICIFVAA-V 575
gi 15622618  302 GHGVLTSDEIEKNGLRMVEIPDWMKETLRKILPPTSVPRNPLDLTG--DANKERYYSALKIVSELN--STKLVIVQAL-P 376
gi 50875547  307 GTGTIAADAVEHTGFKVAEPPSNKTNSLRGRKPIYSDIESPVYVLG--DAPAALYVEAISTAQEDSNVDAIVLVLTPA-A 383
gi 499662478 320 GPGVITADRLELNGLNITGLSAKTINELKTFLPRAASFGNPVDILG--DADEEKYAMTLKTVLDDEKVDGVVAVYGKT-A 396
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 56312692  398 HIRfAEDLLGGEMRgAESMIELarridkPVVVYSLYAPVKPPALRRLHEAGLPVYTSIEYAVRVLAALGERG 469
gi 55230447  387 VLS-FEELSERIVE-QQEQFGK------PVAATLMGGKSVDAGANVLSEAGVPNYFDPARAVGSLGALKRYR 450
gi 2649370   379 QMD-FLKAAESVV-------GK------NAVCCFMGGESVDESERILRSSGIPNFFDPVRAVRAISVLGRYS 436
gi 2496062   385 MTK-PLEVAKSIIEvKNSHKEFkn---kPLITSFVGGVSVKGAKSYLRKNGIPAYITPENGVKALSHLYKYS 452
gi 18893678  388 VLD-PRELAEIVIReYNESGRKk-----PLVVAIVGGIEAKEAIDMLNENGIPAYPEPERAIKALSALYKWS 453
gi 14325495  381 NLD-PSDAAKGIINgVLSSNRKi-----PVVAGFVGGENSINASLYLIKNGIPTFDSPDKAVKAISALRKHQ 446
gi 27983596  386 QTQ-PDEVARLCVEvQKKNPDK------LIVTSFMGGDTMKSPAQILATGNISNYDFPEPALQAIRAVCDYA 450
gi 9502268   384 MTD-PVAVAKSLVEhGPYQNQ-------SLPHGWVNQKSEAGVK-ILEEGKIPNFETPERAVTAFGYIMRHP 446
gi 2649053   576 SEEkSEEVEKAVISaAKYANSVg----kPVVYIYISSDS--KDGVIGDEVKVPVYVFPNTAAKVLGKVVEYA 641
gi 15622618  377 MVS-CTDVARVISNfKGKG-----------VIGITMGLDEDTALKILETTGIPAYTFPEDAVKAIKYFVNKP 436
gi 50875547  384 MTE-AKAVLLGIAEvLDGSKP--------LLCCLMGGGAYVPPMHELVDAGLAIFPTPERAVAAFSAMYNHA 446
gi 499662478 397 VID-MEKMVQAVINgRRKNPDK------PVVACFLGGVDSRRAKELLNKNKIPFYSFPEAAADALAVLYRYY 461
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap