Conserved Protein Domain Family
sider_RhtX_FptX

?
TIGR02718: sider_RhtX_FptX 
siderophore transporter, RhtX/FptX family
RhtX from Sinorhizobium meliloti 2011 and FptX from Pseudomonas aeruginosa appear to be single polypeptide transporters, from the major facilitator family (see pfam07690) for import of siderophores as a means to import iron. This function was suggested by proximity to siderophore biosynthesis genes and then confirmed by study of knockout and heterologous expression phenotypes. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131765
View PSSM: TIGR02718
Aligned: 3 rows
Threshold Bit Score: 490.175
Threshold Setting Gi: 81622117
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81622117   9 RLVITLALLYLSQGIPIGLAMDALPTLLRQDGAPLQALAFLPLVGLPWVVKFLWAPWVDNHWSRR-LGRRRSWILPMQCM 87
gi 52212044   9 RLVITITLLYLSQGIPIGIAMDAMPTLLRHDGAPLHALAFLPLVGLPWVVKFLWAPVVDNRWSAR-IGRRRSWMLPMQCI 87
gi 14524428  33 RLYAVLGGLYLAQGIPTYLLLVALPPLMRESGASRTAIGLFSLLMLPLVLKFAVAPLVDRWAPWPgLGHRRGWVVPTQLL 112
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81622117  88 VLACLLGLATLGLGVASAGWAVGLLALASLASATQDIATDGMAAEHFSGELLAKVNAVQIAGVMIGFFGGGAGSLILAGH 167
gi 52212044  88 VVLCLASLAQIGMTVATAGWAVGLLAVASLASATQDIANDGMAAEHFRGGALAKINAIQIAGVMIGFFGGGAGALTLIGL 167
gi 14524428 113 VSAGIASMALVEPDRAGTLFAIG--ICITLLSSVQDIATDGYAVRHLNGRTLAIGNAVQAGSIALGVIVGGTLTLVLFHK 190
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81622117 168 FGQRTAFLVMACVPLASLCCVLALGRGDPHELPPAPAAKASLLRFLRRPLAPSLLALALLSAMTAVSGFGLSKLYLSDAG 247
gi 52212044 168 FGQRAAFLALAAVPLASLACVLWLMPREAGRPGAPRAHDASLARFAKRPLSLSLLALALLSAMTAVSGFGLSKLFLNDAG 247
gi 14524428 191 IGWRPTILLVACLSLLPLVAAIWMKDRAVASPEAPLRRRASLFGFFRRPNAWMILAFALTYRASEGLVRGMEGSYLVDSK 270
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81622117 248 WALQDIGRLGMSGGLVTVFLGCGGGAWLVRRIGLWRGFALGVVLAGCSALLWYLQAGRWLALSEGLAWTCVLIGSLATGI 327
gi 52212044 248 WTLEAIGRLGMAGGIVTVVLGCGGGAWLVRRLGLWRAFSAGVSCAGAGALLWFAQANGWLASAPHWVWLCTVLGSLSTGI 327
gi 14524428 271 VPTEWIGYMSGAAAATAGLLGALIAALIIRKAGLTATLILLGGLR-SLCFLAFALNAFGIWPGIAVAMSASAFQTLIRYM 349
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 81622117 328 TSVAILTAAMRFAGQGGQAGTDVTAVQSTRDLGEMLASSFLVSLTAQIGYAGGFLTGSALAVLALLLALRL 398
gi 52212044 328 TSVSIMTAGMRFAGDGDQAGTDVTAVQSTRDLGELIASSMMLTLTSKVGYSGGFLAGAVLAALAALIAARL 398
gi 14524428 350 ELVAIYSFFMASSSD-DQPGTDFTILSCAELVVYLIGTSIAGYVADRFGYATLFSSATVISVLGIGLSVWM 419
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap