Conserved Protein Domain Family
repress_PhaQ

?
TIGR02719: repress_PhaQ 
poly-beta-hydroxybutyrate-responsive repressor
Members of this family are transcriptional regulatory proteins found in the vicinity of poly-beta-hydroxybutyrate (PHB) operons in several species of Bacillus. This protein appears to have repressor activity modulated by PHB itself. This protein belongs to the larger PadR family (see pfam03551). [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131766
View PSSM: TIGR02719
Aligned: 2 rows
Threshold Bit Score: 251.474
Threshold Setting Gi: 4160472
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47501742   4 NEPEQrESLENTQAKQPNSMPKNFLVPFLLLCLKDWSLHGYKLIQMLMDIGFSSVDQGNVYRTLRKLEKENLISSTWDTS 83
gi 4160472    4 SEKDN-TSNSNNLEKSISGAPKNLMVPFLLLSLRGWNLHGYKLIQQLMSFGFTSVDQGNVYRTLRQLEKDNLITSQWDTS 82
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 47501742  84 DGGPAKRIYSLTEYGEQYLTTCATSFEHYQNMLRTFFTLYTNAFFPFSTSPEKDEKDS 141
gi 4160472   83 AEGPARRIYSLTDAGEQYLSMWANSLEQYQNMLDSFFHMYTDMLFPFSSSSSKKSKES 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap