Conserved Protein Domain Family
phenyl_P_alpha

?
TIGR02723: phenyl_P_alpha 
phenylphosphate carboxylase, alpha subunit
Members of this protein family are the alpha subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. This alpha subunit is homologous to the beta subunit and, more broadly, to UbiD family decarboxylases. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 131770
View PSSM: TIGR02723
Aligned: 2 rows
Threshold Bit Score: 994.598
Threshold Setting Gi: 56313238
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123   1 MGKISAPKNNREFIEACVKSGDAVRIRQEVDWDNEAGAIVRRACELAEAAPFMENIKDYPGFSYFGAPLSTYRRMAISLG 80
gi 56313238   1 MAKISAPKNNREFIEACVRSGDAVRIRQEVDWDNEAGAIVRRVCELGEAAPFMENIKDYPGFSYFGAPLSTYRRMAISLG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123  81 MDPASTLPQIGAEYLKRTNSEPVAPVIVDKRDAPCKENILLGADVDLTKLPVPLVHDGDGGRYVGTWHAVITKHPVRGDV 160
gi 56313238  81 MDPASTLPQIGAEYLKRTNSEPIEPVVIDRRDAPCKENILLGDDVDLTKLPVPLVHDGDGGRYVGTWHAVITRHPVRGDV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123 161 NWGMYRQMMWDGRTMSGAVFPFSDLGKALTEYYLPRGEGCPFATAIGLSPLAAMAACAPSPIPEPELTGMLAGEPVRLVK 240
gi 56313238 161 NWGMYRQMMWDGRTMSGAVFPFSDLGKALTDYYLPRGEGCPFATAIGLSPLAAMAACAPSPIPEPELCGMLSGEAVRLVK 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123 241 CETNDLEVPADAEIIIEGVILPDYKVEEGPFGEYTGYRTSPRDFRVTFRVDAITYRNNATMTISNMGVPQDEGQLLRSFS 320
gi 56313238 241 CETNDLEVPADAEIIIEGMILPDYKVEEGPFGEYTGYRTSPRDFRVTFRVDAITYRNNATMTISNMGVPQDEGQLLRSFS 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123 321 LGLELEKLLKSQGIPVTGVYMHPRSTHHMMIVGVKPTYAGIAMQIAQLAFGSKLGPWFHMVMVVDDQTDIFNWDEVYHAF 400
gi 56313238 321 LGLELEKLLKSQGIPVTGVYMHPRSTHHMMIVGVKPTYAGIAMQIAQLAFGSKLGPWFHMVMVVDDQTDIFNWDEVYHAF 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697123 401 CTRCNPERGIHVFKNTTGTALYPHATPHDRKYSIGSQVLFDCLWPVDWDKTNDVPTLVSFKNVYPKDIQEKVTNNWTDYG 480
gi 56313238 401 CTRCNPERGIHVFKNTTGTALYPHATPHDRKYSIGSQVLFDCLWPVDWDKTNDVPSVVSFKKVYPQDIQDKVTNSWTDYG 480

                ....*
gi 10697123 481 FKPVK 485
gi 56313238 481 FKPVK 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap