Conserved Protein Domain Family
phenyl_P_beta

?
TIGR02724: phenyl_P_beta 
phenylphosphate carboxylase, beta subunit
Members of this protein family are the beta subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. This beta subunit is homologous to the alpha subunit and, more broadly, to UbiD family decarboxylases.
Statistics
?
PSSM-Id: 131771
View PSSM: TIGR02724
Aligned: 2 rows
Threshold Bit Score: 983.048
Threshold Setting Gi: 56313240
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697121   1 MDLRYFINQCAEAHELKRITTEVDWNLEISHVSKLTEEKKGPALLFESIKGYDTPVFTGAFATTKRLAVMLGLPHNLSLC 80
gi 56313240   1 MDLRYFINQCAEAHELKRVTTEVDWNLEISHVSKLTEEKKGPALLFESIKGYDTPVFTGAFATTKRLAIMLGLPHHLTLC 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697121  81 ESAQQWMKKTITSEGLIKAKEVKDGPVLENVLSGDKVDLNMFPVPKFFPLDGGRYIGTMVSVVLRDPETGEVNLGTYRMQ 160
gi 56313240  81 ESAQQWMKKTITSEGLIKAKEVKDGPVLENVLSGGKVDLNMFPVPKFFPLDGGRYIGTMVSVVLRDPETGEVNLGTYRMQ 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697121 161 MLDDKRCGVQILPGKRGERIMKKYAKMGKKMPAAAIIGCDPLIFMSGTLMHKGASDFDITGTVRGQQAEFLMAPLTGLPV 240
gi 56313240 161 MLDDKRCGVQILPGKRGERIMKKYAKLGKKMPAAAIIGCDPLIFMAGTLMHKGASDFDITGTVRGQQAEFLMAPLTGLPV 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697121 241 PAGAEIVLEGEIDPNAFLPEGPFAEYTGYYTDELHKPIPKPVLEVQQILHRNSPILWATGQGRPVTDVHMLLAFTRTATL 320
gi 56313240 241 PAGAEIVLEGEIDPNAFLPEGPFAEYTGYYTDELHKPIPKPVLEVQQILHRNNPILWATGQGRPVTDVHMLLAFTRTATL 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10697121 321 WTELEQMRIPGIQSVCVMPESTGRFWSVVSVKQAYPGHSRQVADAVIASNTGSYGMKGVITVDEDIQADDLQRVFWALSC 400
gi 56313240 321 WTELEQMRIPGVQSVCVLPESTGRFWSVVSLKQAYPGHSRQVADAVMGSNTGSYGMKGIITVDEDIAADDLQRVFWALSC 400
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 10697121 401 RYDPARGTELIKRGRSTPLDPALDPNGDKLTTSRILMDACIPYEWKQKPVEARMDEEMLAKIRARWHEYGID 472
gi 56313240 401 RYDPMRGTELIKRGRSTPLDPALDPDGDKLTTSRILMDACIPYEWKQKPVEARMDEEMLAKIRARWHEYGID 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap